Detailed information
Overview
| Name | degQ | Type | Regulator |
| Locus tag | HT135_RS16800 | Genome accession | NZ_CP054584 |
| Coordinates | 3254488..3254628 (-) | Length | 46 a.a. |
| NCBI ID | WP_024122683.1 | Uniprot ID | A0A9Q4HP57 |
| Organism | Bacillus halotolerans strain KKD1 | ||
| Function | modification of regulators (predicted from homology) Competence regulation |
||
Genomic Context
Location: 3249488..3259628
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| HT135_RS16775 (HT135_16770) | - | 3249770..3250150 (-) | 381 | WP_044158943.1 | hotdog fold thioesterase | - |
| HT135_RS16780 (HT135_16775) | comA | 3250168..3250812 (-) | 645 | WP_024122680.1 | two-component system response regulator ComA | Regulator |
| HT135_RS16785 (HT135_16780) | - | 3250893..3253200 (-) | 2308 | Protein_3280 | histidine kinase | - |
| HT135_RS16790 (HT135_16785) | comX | 3253216..3253437 (-) | 222 | WP_059292642.1 | competence pheromone ComX | - |
| HT135_RS16795 (HT135_16790) | - | 3253434..3254303 (-) | 870 | WP_101864136.1 | polyprenyl synthetase family protein | - |
| HT135_RS16800 (HT135_16795) | degQ | 3254488..3254628 (-) | 141 | WP_024122683.1 | degradation enzyme regulation protein DegQ | Regulator |
| HT135_RS16805 (HT135_16800) | - | 3255089..3255457 (+) | 369 | WP_106019478.1 | hypothetical protein | - |
| HT135_RS16810 (HT135_16805) | - | 3255433..3256662 (-) | 1230 | WP_106019479.1 | EAL and HDOD domain-containing protein | - |
| HT135_RS16815 (HT135_16810) | - | 3256798..3258267 (-) | 1470 | WP_024122686.1 | nicotinate phosphoribosyltransferase | - |
| HT135_RS16820 (HT135_16815) | - | 3258283..3258834 (-) | 552 | WP_106019480.1 | cysteine hydrolase family protein | - |
| HT135_RS16825 (HT135_16820) | - | 3258931..3259329 (-) | 399 | WP_106019481.1 | YueI family protein | - |
Sequence
Protein
Download Length: 46 a.a. Molecular weight: 5533.44 Da Isoelectric Point: 6.2559
>NTDB_id=453739 HT135_RS16800 WP_024122683.1 3254488..3254628(-) (degQ) [Bacillus halotolerans strain KKD1]
MEKKLEEVKQLLFRLELDIKETTDSLRNINKSIDQLDKYTYAMKIS
MEKKLEEVKQLLFRLELDIKETTDSLRNINKSIDQLDKYTYAMKIS
Nucleotide
Download Length: 141 bp
>NTDB_id=453739 HT135_RS16800 WP_024122683.1 3254488..3254628(-) (degQ) [Bacillus halotolerans strain KKD1]
ATGGAAAAGAAACTTGAAGAAGTAAAACAATTGTTATTCCGACTCGAACTTGATATTAAAGAAACGACAGATTCATTACG
AAACATTAACAAAAGCATTGATCAGCTCGATAAATACACATACGCAATGAAAATTTCGTAA
ATGGAAAAGAAACTTGAAGAAGTAAAACAATTGTTATTCCGACTCGAACTTGATATTAAAGAAACGACAGATTCATTACG
AAACATTAACAAAAGCATTGATCAGCTCGATAAATACACATACGCAATGAAAATTTCGTAA
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| degQ | Bacillus subtilis subsp. subtilis str. 168 |
97.826 |
100 |
0.978 |