Detailed information    

insolico Bioinformatically predicted

Overview

Name   comGE   Type   Machinery gene
Locus tag   HUF97_RS11610 Genome accession   NZ_CP054562
Coordinates   2440191..2440505 (-) Length   104 a.a.
NCBI ID   WP_032874016.1    Uniprot ID   -
Organism   Bacillus velezensis strain YB-130     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context

Location: 2435191..2445505
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  HUF97_RS11565 sinI 2435872..2436045 (+) 174 WP_032874029.1 anti-repressor SinI Regulator
  HUF97_RS11570 sinR 2436079..2436414 (+) 336 WP_003153104.1 transcriptional regulator SinR Regulator
  HUF97_RS11575 tasA 2436462..2437247 (-) 786 WP_032874027.1 biofilm matrix protein TasA -
  HUF97_RS11580 sipW 2437312..2437896 (-) 585 WP_032874025.1 signal peptidase I SipW -
  HUF97_RS11585 tapA 2437868..2438539 (-) 672 WP_032874023.1 amyloid fiber anchoring/assembly protein TapA -
  HUF97_RS11590 - 2438798..2439127 (+) 330 WP_032874021.1 DUF3889 domain-containing protein -
  HUF97_RS11595 - 2439168..2439347 (-) 180 WP_022552966.1 YqzE family protein -
  HUF97_RS11600 comGG 2439404..2439781 (-) 378 WP_032874019.1 competence type IV pilus minor pilin ComGG Machinery gene
  HUF97_RS11605 comGF 2439782..2440282 (-) 501 WP_223204419.1 competence type IV pilus minor pilin ComGF -
  HUF97_RS11610 comGE 2440191..2440505 (-) 315 WP_032874016.1 competence type IV pilus minor pilin ComGE Machinery gene
  HUF97_RS11615 comGD 2440489..2440926 (-) 438 WP_007612572.1 competence type IV pilus minor pilin ComGD Machinery gene
  HUF97_RS11620 comGC 2440916..2441224 (-) 309 WP_003153087.1 competence type IV pilus major pilin ComGC Machinery gene
  HUF97_RS11625 comGB 2441229..2442266 (-) 1038 WP_032874014.1 competence type IV pilus assembly protein ComGB Machinery gene
  HUF97_RS11630 comGA 2442253..2443323 (-) 1071 WP_003153083.1 competence type IV pilus ATPase ComGA Machinery gene
  HUF97_RS11635 - 2443520..2444470 (-) 951 WP_032874012.1 magnesium transporter CorA family protein -

Sequence

Protein


Download         Length: 104 a.a.        Molecular weight: 11902.88 Da        Isoelectric Point: 5.8321

>NTDB_id=453370 HUF97_RS11610 WP_032874016.1 2440191..2440505(-) (comGE) [Bacillus velezensis strain YB-130]
MLNGNKGFSTIETLSAMAIWLFLMTSIIPVWTDMLTDGLKIEDRQEAYQLLQKHISTYMMTGKKPPSPGVKWKEDGEYYK
VCAADRGEKEMCLSILKTDWLYAS

Nucleotide


Download         Length: 315 bp        

>NTDB_id=453370 HUF97_RS11610 WP_032874016.1 2440191..2440505(-) (comGE) [Bacillus velezensis strain YB-130]
ATGCTAAACGGAAATAAGGGGTTCTCTACTATTGAAACACTATCAGCAATGGCCATTTGGCTGTTCCTTATGACGTCTAT
CATTCCGGTCTGGACGGACATGCTGACAGATGGTCTGAAAATAGAAGATCGCCAGGAAGCGTACCAGCTTCTTCAGAAAC
ATATCAGCACTTATATGATGACCGGAAAAAAGCCGCCGTCTCCCGGTGTGAAGTGGAAGGAGGATGGTGAGTATTACAAA
GTGTGTGCGGCTGACCGCGGTGAAAAAGAAATGTGCCTCAGTATTCTCAAAACAGACTGGCTTTACGCTTCTTAA

Domains


No domain identified.



Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGE Bacillus subtilis subsp. subtilis str. 168

43.478

100

0.481