Detailed information    

insolico Bioinformatically predicted

Overview

Name   sinI   Type   Regulator
Locus tag   HUF97_RS11565 Genome accession   NZ_CP054562
Coordinates   2435872..2436045 (+) Length   57 a.a.
NCBI ID   WP_032874029.1    Uniprot ID   -
Organism   Bacillus velezensis strain YB-130     
Function   inhibit the expression of sinR (predicted from homology)   
Competence regulation

Genomic Context

Location: 2430872..2441045
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  HUF97_RS11550 gcvT 2431686..2432786 (-) 1101 WP_032874033.1 glycine cleavage system aminomethyltransferase GcvT -
  HUF97_RS11555 - 2433209..2434879 (+) 1671 WP_032874031.1 DEAD/DEAH box helicase -
  HUF97_RS11560 - 2434901..2435695 (+) 795 WP_007612541.1 YqhG family protein -
  HUF97_RS11565 sinI 2435872..2436045 (+) 174 WP_032874029.1 anti-repressor SinI Regulator
  HUF97_RS11570 sinR 2436079..2436414 (+) 336 WP_003153104.1 transcriptional regulator SinR Regulator
  HUF97_RS11575 tasA 2436462..2437247 (-) 786 WP_032874027.1 biofilm matrix protein TasA -
  HUF97_RS11580 sipW 2437312..2437896 (-) 585 WP_032874025.1 signal peptidase I SipW -
  HUF97_RS11585 tapA 2437868..2438539 (-) 672 WP_032874023.1 amyloid fiber anchoring/assembly protein TapA -
  HUF97_RS11590 - 2438798..2439127 (+) 330 WP_032874021.1 DUF3889 domain-containing protein -
  HUF97_RS11595 - 2439168..2439347 (-) 180 WP_022552966.1 YqzE family protein -
  HUF97_RS11600 comGG 2439404..2439781 (-) 378 WP_032874019.1 competence type IV pilus minor pilin ComGG Machinery gene
  HUF97_RS11605 comGF 2439782..2440282 (-) 501 WP_223204419.1 competence type IV pilus minor pilin ComGF -
  HUF97_RS11610 comGE 2440191..2440505 (-) 315 WP_032874016.1 competence type IV pilus minor pilin ComGE Machinery gene
  HUF97_RS11615 comGD 2440489..2440926 (-) 438 WP_007612572.1 competence type IV pilus minor pilin ComGD Machinery gene

Sequence

Protein


Download         Length: 57 a.a.        Molecular weight: 6658.66 Da        Isoelectric Point: 9.8168

>NTDB_id=453367 HUF97_RS11565 WP_032874029.1 2435872..2436045(+) (sinI) [Bacillus velezensis strain YB-130]
MKNAKMEFSQLDKEWVELILEAQKANISLEEIRKYLLSNKKSSQHVQAARSHTVNPF

Nucleotide


Download         Length: 174 bp        

>NTDB_id=453367 HUF97_RS11565 WP_032874029.1 2435872..2436045(+) (sinI) [Bacillus velezensis strain YB-130]
ATGAAAAATGCAAAAATGGAATTTTCGCAATTAGATAAGGAATGGGTTGAGCTGATATTAGAAGCCCAAAAAGCAAATAT
CAGCCTAGAAGAAATACGCAAATACCTGCTTTCGAATAAAAAGTCTTCTCAACATGTCCAGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA

Domains

Predicted by InterproScan.

Anti-repressor SinI (SinI)

(11-37)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sinI Bacillus subtilis subsp. subtilis str. 168

71.93

100

0.719