Detailed information
Overview
| Name | sinI | Type | Regulator |
| Locus tag | HUF97_RS11565 | Genome accession | NZ_CP054562 |
| Coordinates | 2435872..2436045 (+) | Length | 57 a.a. |
| NCBI ID | WP_032874029.1 | Uniprot ID | - |
| Organism | Bacillus velezensis strain YB-130 | ||
| Function | inhibit the expression of sinR (predicted from homology) Competence regulation |
||
Genomic Context
Location: 2430872..2441045
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| HUF97_RS11550 | gcvT | 2431686..2432786 (-) | 1101 | WP_032874033.1 | glycine cleavage system aminomethyltransferase GcvT | - |
| HUF97_RS11555 | - | 2433209..2434879 (+) | 1671 | WP_032874031.1 | DEAD/DEAH box helicase | - |
| HUF97_RS11560 | - | 2434901..2435695 (+) | 795 | WP_007612541.1 | YqhG family protein | - |
| HUF97_RS11565 | sinI | 2435872..2436045 (+) | 174 | WP_032874029.1 | anti-repressor SinI | Regulator |
| HUF97_RS11570 | sinR | 2436079..2436414 (+) | 336 | WP_003153104.1 | transcriptional regulator SinR | Regulator |
| HUF97_RS11575 | tasA | 2436462..2437247 (-) | 786 | WP_032874027.1 | biofilm matrix protein TasA | - |
| HUF97_RS11580 | sipW | 2437312..2437896 (-) | 585 | WP_032874025.1 | signal peptidase I SipW | - |
| HUF97_RS11585 | tapA | 2437868..2438539 (-) | 672 | WP_032874023.1 | amyloid fiber anchoring/assembly protein TapA | - |
| HUF97_RS11590 | - | 2438798..2439127 (+) | 330 | WP_032874021.1 | DUF3889 domain-containing protein | - |
| HUF97_RS11595 | - | 2439168..2439347 (-) | 180 | WP_022552966.1 | YqzE family protein | - |
| HUF97_RS11600 | comGG | 2439404..2439781 (-) | 378 | WP_032874019.1 | competence type IV pilus minor pilin ComGG | Machinery gene |
| HUF97_RS11605 | comGF | 2439782..2440282 (-) | 501 | WP_223204419.1 | competence type IV pilus minor pilin ComGF | - |
| HUF97_RS11610 | comGE | 2440191..2440505 (-) | 315 | WP_032874016.1 | competence type IV pilus minor pilin ComGE | Machinery gene |
| HUF97_RS11615 | comGD | 2440489..2440926 (-) | 438 | WP_007612572.1 | competence type IV pilus minor pilin ComGD | Machinery gene |
Sequence
Protein
Download Length: 57 a.a. Molecular weight: 6658.66 Da Isoelectric Point: 9.8168
>NTDB_id=453367 HUF97_RS11565 WP_032874029.1 2435872..2436045(+) (sinI) [Bacillus velezensis strain YB-130]
MKNAKMEFSQLDKEWVELILEAQKANISLEEIRKYLLSNKKSSQHVQAARSHTVNPF
MKNAKMEFSQLDKEWVELILEAQKANISLEEIRKYLLSNKKSSQHVQAARSHTVNPF
Nucleotide
Download Length: 174 bp
>NTDB_id=453367 HUF97_RS11565 WP_032874029.1 2435872..2436045(+) (sinI) [Bacillus velezensis strain YB-130]
ATGAAAAATGCAAAAATGGAATTTTCGCAATTAGATAAGGAATGGGTTGAGCTGATATTAGAAGCCCAAAAAGCAAATAT
CAGCCTAGAAGAAATACGCAAATACCTGCTTTCGAATAAAAAGTCTTCTCAACATGTCCAGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA
ATGAAAAATGCAAAAATGGAATTTTCGCAATTAGATAAGGAATGGGTTGAGCTGATATTAGAAGCCCAAAAAGCAAATAT
CAGCCTAGAAGAAATACGCAAATACCTGCTTTCGAATAAAAAGTCTTCTCAACATGTCCAGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| sinI | Bacillus subtilis subsp. subtilis str. 168 |
71.93 |
100 |
0.719 |