Detailed information    

insolico Bioinformatically predicted

Overview

Name   cipB   Type   Regulator
Locus tag   I6H76_RS07045 Genome accession   NZ_CP065994
Coordinates   1371224..1371424 (+) Length   66 a.a.
NCBI ID   WP_006531882.1    Uniprot ID   A0ABP2DHE2
Organism   Streptococcus infantarius strain FDAARGOS_1019     
Function   indirect induction of ComX; activation of comRS system (predicted from homology)   
Competence regulation

Genomic Context

Location: 1366224..1376424
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  I6H76_RS06990 (I6H76_06990) - 1366475..1366633 (+) 159 WP_006531869.1 ComC/BlpC family leader-containing pheromone/bacteriocin -
  I6H76_RS06995 (I6H76_06995) - 1366661..1366816 (+) 156 WP_006531870.1 bacteriocin -
  I6H76_RS07000 (I6H76_07000) - 1366856..1367530 (+) 675 WP_006531871.1 CPBP family intramembrane glutamic endopeptidase -
  I6H76_RS07005 (I6H76_07005) - 1367871..1368173 (+) 303 WP_006531872.1 hypothetical protein -
  I6H76_RS07010 (I6H76_07010) - 1368252..1368455 (+) 204 WP_081442276.1 garvicin Q family class II bacteriocin -
  I6H76_RS07015 (I6H76_07015) - 1368467..1368769 (+) 303 WP_006531874.1 bacteriocin immunity protein -
  I6H76_RS07020 (I6H76_07020) cipB 1368927..1369160 (+) 234 WP_006531875.1 Blp family class II bacteriocin Regulator
  I6H76_RS07025 (I6H76_07025) - 1369180..1369368 (+) 189 WP_006531876.1 class IIb bacteriocin, lactobin A/cerein 7B family -
  I6H76_RS07030 (I6H76_07030) - 1370118..1370336 (+) 219 WP_006531878.1 Blp family class II bacteriocin -
  I6H76_RS07035 (I6H76_07035) - 1370336..1370632 (+) 297 WP_006531879.1 bacteriocin immunity protein -
  I6H76_RS07040 (I6H76_07040) - 1370801..1371034 (+) 234 WP_006531880.1 Blp family class II bacteriocin -
  I6H76_RS07045 (I6H76_07045) cipB 1371224..1371424 (+) 201 WP_006531882.1 bacteriocin class II family protein Regulator
  I6H76_RS07050 (I6H76_07050) - 1371450..1371632 (+) 183 WP_006531883.1 Blp family class II bacteriocin -
  I6H76_RS07055 (I6H76_07055) - 1372250..1372480 (+) 231 WP_043878356.1 bacteriocin -
  I6H76_RS07060 (I6H76_07060) - 1372569..1372880 (+) 312 WP_003066586.1 hypothetical protein -
  I6H76_RS07065 (I6H76_07065) - 1373094..1373186 (+) 93 Protein_1343 Blp family class II bacteriocin -
  I6H76_RS07070 (I6H76_07070) - 1373244..1373648 (+) 405 WP_018364981.1 hypothetical protein -
  I6H76_RS07075 (I6H76_07075) - 1373829..1374875 (+) 1047 WP_006531888.1 thioredoxin fold domain-containing protein -
  I6H76_RS07080 (I6H76_07080) - 1375380..1376045 (+) 666 WP_006531890.1 DUF6261 family protein -

Sequence

Protein


Download         Length: 66 a.a.        Molecular weight: 6536.51 Da        Isoelectric Point: 6.1394

>NTDB_id=452833 I6H76_RS07045 WP_006531882.1 1371224..1371424(+) (cipB) [Streptococcus infantarius strain FDAARGOS_1019]
MNTKAFEQFDVMTDAELSTVEGGKSKEGRNMGCILGTAGMAGAGFLVAGPAGAAALGGATALRVCR

Nucleotide


Download         Length: 201 bp        

>NTDB_id=452833 I6H76_RS07045 WP_006531882.1 1371224..1371424(+) (cipB) [Streptococcus infantarius strain FDAARGOS_1019]
ATGAATACAAAAGCATTTGAACAATTTGATGTAATGACAGATGCAGAACTTTCAACTGTTGAAGGTGGGAAAAGTAAAGA
AGGAAGAAATATGGGATGTATACTTGGCACTGCAGGTATGGCAGGAGCAGGCTTTTTAGTAGCAGGACCAGCAGGTGCTG
CCGCACTTGGCGGTGCTACCGCACTAAGAGTTTGTAGATAA

Domains

Predicted by InterProScan.

Bacteriocin class II with double-glycine leader peptide (Bacteriocin_IIc)

(6-58)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  cipB Streptococcus mutans UA159

52.174

69.697

0.364