Detailed information    

insolico Bioinformatically predicted

Overview


Name   cipB   Type   Regulator
Locus tag   I6H76_RS07020 Genome accession   NZ_CP065994
Coordinates   1368927..1369160 (+) Length   77 a.a.
NCBI ID   WP_006531875.1    Uniprot ID   A0ABM9XEM8
Organism   Streptococcus infantarius strain FDAARGOS_1019     
Function   indirect induction of ComX; activation of comRS system (predicted from homology)   
Competence regulation

Genomic Context


Location: 1363927..1374160
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  I6H76_RS06970 (I6H76_06970) - 1364924..1365181 (+) 258 WP_006531864.1 bacteriocin class II family protein -
  I6H76_RS06975 (I6H76_06975) - 1365199..1365393 (+) 195 WP_043878345.1 class IIb bacteriocin, lactobin A/cerein 7B family -
  I6H76_RS06980 (I6H76_06980) cipB 1365589..1365816 (+) 228 WP_006531867.1 Blp family class II bacteriocin Regulator
  I6H76_RS06985 (I6H76_06985) - 1365818..1366006 (+) 189 WP_115283782.1 class IIb bacteriocin, lactobin A/cerein 7B family -
  I6H76_RS06990 (I6H76_06990) - 1366475..1366633 (+) 159 WP_006531869.1 ComC/BlpC family leader-containing pheromone/bacteriocin -
  I6H76_RS06995 (I6H76_06995) - 1366661..1366816 (+) 156 WP_006531870.1 bacteriocin -
  I6H76_RS07000 (I6H76_07000) - 1366856..1367530 (+) 675 WP_006531871.1 CPBP family intramembrane glutamic endopeptidase -
  I6H76_RS07005 (I6H76_07005) - 1367871..1368173 (+) 303 WP_006531872.1 hypothetical protein -
  I6H76_RS07010 (I6H76_07010) - 1368252..1368455 (+) 204 WP_081442276.1 garvicin Q family class II bacteriocin -
  I6H76_RS07015 (I6H76_07015) - 1368467..1368769 (+) 303 WP_006531874.1 bacteriocin immunity protein -
  I6H76_RS07020 (I6H76_07020) cipB 1368927..1369160 (+) 234 WP_006531875.1 Blp family class II bacteriocin Regulator
  I6H76_RS07025 (I6H76_07025) - 1369180..1369368 (+) 189 WP_006531876.1 class IIb bacteriocin, lactobin A/cerein 7B family -
  I6H76_RS07030 (I6H76_07030) - 1370118..1370336 (+) 219 WP_006531878.1 Blp family class II bacteriocin -
  I6H76_RS07035 (I6H76_07035) - 1370336..1370632 (+) 297 WP_006531879.1 bacteriocin immunity protein -
  I6H76_RS07040 (I6H76_07040) - 1370801..1371034 (+) 234 WP_006531880.1 Blp family class II bacteriocin -
  I6H76_RS07045 (I6H76_07045) cipB 1371224..1371424 (+) 201 WP_006531882.1 bacteriocin class II family protein Regulator
  I6H76_RS07050 (I6H76_07050) - 1371450..1371632 (+) 183 WP_006531883.1 Blp family class II bacteriocin -
  I6H76_RS07055 (I6H76_07055) - 1372250..1372480 (+) 231 WP_043878356.1 bacteriocin -
  I6H76_RS07060 (I6H76_07060) - 1372569..1372880 (+) 312 WP_003066586.1 hypothetical protein -
  I6H76_RS07065 (I6H76_07065) - 1373094..1373186 (+) 93 Protein_1343 Blp family class II bacteriocin -
  I6H76_RS07070 (I6H76_07070) - 1373244..1373648 (+) 405 WP_018364981.1 hypothetical protein -

Sequence


Protein


Download         Length: 77 a.a.        Molecular weight: 7530.65 Da        Isoelectric Point: 4.6641

>NTDB_id=452832 I6H76_RS07020 WP_006531875.1 1368927..1369160(+) (cipB) [Streptococcus infantarius strain FDAARGOS_1019]
MNTKAFEQFDVMTDVELAKVEGGNKCVNAIFGGALTGAGSGFVGGMATLGVTSIPGAFVGAHFGAIAGGLYCVGASL

Nucleotide


Download         Length: 234 bp        

>NTDB_id=452832 I6H76_RS07020 WP_006531875.1 1368927..1369160(+) (cipB) [Streptococcus infantarius strain FDAARGOS_1019]
ATGAATACAAAAGCATTTGAACAATTTGATGTAATGACAGACGTAGAACTTGCTAAAGTTGAAGGTGGAAACAAATGTGT
TAATGCAATTTTTGGTGGCGCATTAACAGGTGCAGGATCAGGATTTGTAGGTGGTATGGCAACGCTTGGTGTTACTTCAA
TTCCAGGAGCATTTGTTGGAGCCCATTTTGGAGCAATAGCTGGTGGCTTATATTGTGTAGGTGCTAGTCTTTGA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  cipB Streptococcus mutans UA159

50

75.325

0.377