Detailed information    

insolico Bioinformatically predicted

Overview


Name   comX   Type   Regulator
Locus tag   HR084_RS15990 Genome accession   NZ_CP054177
Coordinates   3128312..3128479 (-) Length   55 a.a.
NCBI ID   WP_003242801.1    Uniprot ID   G9LQ80
Organism   Bacillus subtilis strain JCL16     
Function   binding to ComP; trigger autophosphorylation of ComP (predicted from homology)   
Competence regulation

Genomic Context


Location: 3123312..3133479
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  HR084_RS15960 (HR084_15960) mrpE 3123705..3124181 (+) 477 WP_003228815.1 Na+/H+ antiporter subunit E -
  HR084_RS15965 (HR084_15965) mrpF 3124181..3124465 (+) 285 WP_003228814.1 Na(+)/H(+) antiporter subunit F1 -
  HR084_RS15970 (HR084_15970) mnhG 3124449..3124823 (+) 375 WP_003244302.1 monovalent cation/H(+) antiporter subunit G -
  HR084_RS15975 (HR084_15975) yuxO 3124864..3125244 (-) 381 WP_017695528.1 hotdog fold thioesterase -
  HR084_RS15980 (HR084_15980) comA 3125263..3125907 (-) 645 WP_003220716.1 two-component system response regulator ComA Regulator
  HR084_RS15985 (HR084_15985) comP 3125988..3128297 (-) 2310 Protein_3108 two-component system sensor histidine kinase ComP -
  HR084_RS15990 (HR084_15990) comX 3128312..3128479 (-) 168 WP_003242801.1 competence pheromone ComX Regulator
  HR084_RS15995 (HR084_15995) comQ 3128467..3129366 (-) 900 WP_173614277.1 ComX modifying isoprenyl transferase ComQ Regulator
  HR084_RS16000 (HR084_16000) degQ 3129551..3129691 (-) 141 WP_003220708.1 degradation enzyme regulation protein DegQ Regulator
  HR084_RS16005 (HR084_16005) - 3129913..3130038 (+) 126 WP_003228793.1 hypothetical protein -
  HR084_RS16010 (HR084_16010) - 3130152..3130520 (+) 369 WP_014477834.1 hypothetical protein -
  HR084_RS16015 (HR084_16015) pdeH 3130496..3131725 (-) 1230 WP_003243525.1 cyclic di-GMP phosphodiesterase -
  HR084_RS16020 (HR084_16020) pncB 3131862..3133334 (-) 1473 WP_003228788.1 nicotinate phosphoribosyltransferase -

Sequence


Protein


Download         Length: 55 a.a.        Molecular weight: 6518.42 Da        Isoelectric Point: 4.3285

>NTDB_id=451352 HR084_RS15990 WP_003242801.1 3128312..3128479(-) (comX) [Bacillus subtilis strain JCL16]
MQDLINYFLNYPEALKKLKNKEACLIGFDVQETETIIKAYNDYYLADPITRQWGD

Nucleotide


Download         Length: 168 bp        

>NTDB_id=451352 HR084_RS15990 WP_003242801.1 3128312..3128479(-) (comX) [Bacillus subtilis strain JCL16]
ATGCAAGACCTAATTAACTACTTTTTAAATTATCCTGAGGCTTTAAAAAAATTGAAAAATAAAGAAGCCTGCCTTATAGG
TTTTGATGTGCAAGAAACTGAAACAATAATTAAAGCTTATAATGATTATTATCTGGCTGATCCAATAACCCGTCAATGGG
GTGATTAA

Domains



No domain identified.



Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB G9LQ80

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comX Bacillus subtilis subsp. subtilis str. 168

100

100

1