Detailed information    

insolico Bioinformatically predicted

Overview


Name   comGF   Type   Machinery gene
Locus tag   HR084_RS12385 Genome accession   NZ_CP054177
Coordinates   2448759..2449142 (-) Length   127 a.a.
NCBI ID   WP_029317913.1    Uniprot ID   -
Organism   Bacillus subtilis strain JCL16     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 2443759..2454142
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  HR084_RS12345 (HR084_12345) sinI 2444692..2444865 (+) 174 WP_003230187.1 anti-repressor SinI Regulator
  HR084_RS12350 (HR084_12350) sinR 2444899..2445234 (+) 336 WP_003226345.1 transcriptional regulator SinR Regulator
  HR084_RS12355 (HR084_12355) tasA 2445327..2446112 (-) 786 WP_014664586.1 biofilm matrix protein TasA -
  HR084_RS12360 (HR084_12360) sipW 2446176..2446748 (-) 573 WP_003246088.1 signal peptidase I SipW -
  HR084_RS12365 (HR084_12365) tapA 2446732..2447493 (-) 762 WP_029726724.1 amyloid fiber anchoring/assembly protein TapA -
  HR084_RS12370 (HR084_12370) yqzG 2447765..2448091 (+) 327 WP_003246051.1 YqzG/YhdC family protein -
  HR084_RS12375 (HR084_12375) spoIITA 2448133..2448312 (-) 180 WP_029726723.1 YqzE family protein -
  HR084_RS12380 (HR084_12380) comGG 2448384..2448758 (-) 375 WP_029726722.1 ComG operon protein ComGG Machinery gene
  HR084_RS12385 (HR084_12385) comGF 2448759..2449142 (-) 384 WP_029317913.1 ComG operon protein ComGF Machinery gene
  HR084_RS12390 (HR084_12390) comGE 2449168..2449515 (-) 348 WP_014480255.1 ComG operon protein 5 Machinery gene
  HR084_RS12395 (HR084_12395) comGD 2449499..2449930 (-) 432 WP_014480256.1 comG operon protein ComGD Machinery gene
  HR084_RS12400 (HR084_12400) comGC 2449920..2450216 (-) 297 WP_014477332.1 comG operon protein ComGC Machinery gene
  HR084_RS12405 (HR084_12405) comGB 2450230..2451267 (-) 1038 WP_173614185.1 comG operon protein ComGB Machinery gene
  HR084_RS12410 (HR084_12410) comGA 2451254..2452324 (-) 1071 WP_069322755.1 competence protein ComGA Machinery gene
  HR084_RS12415 (HR084_12415) corA 2452735..2453688 (-) 954 WP_029317911.1 magnesium transporter CorA -

Sequence


Protein


Download         Length: 127 a.a.        Molecular weight: 14363.43 Da        Isoelectric Point: 5.8949

>NTDB_id=451332 HR084_RS12385 WP_029317913.1 2448759..2449142(-) (comGF) [Bacillus subtilis strain JCL16]
MLISGSLAAIFHLFLSRQQEHDGFTQQEWMISIEQMMNECKESQAVKTAEHGSVLICTNLSGQDIRFEIYHSMIRKRVDG
KGHVPILDHITAMKADFENGVVLLKIESEDQKVYQTAFPVYSYLGGG

Nucleotide


Download         Length: 384 bp        

>NTDB_id=451332 HR084_RS12385 WP_029317913.1 2448759..2449142(-) (comGF) [Bacillus subtilis strain JCL16]
TTGCTCATATCAGGATCGTTAGCTGCGATTTTCCATCTGTTTTTGTCTCGACAGCAGGAACATGACGGTTTCACACAGCA
AGAATGGATGATTTCGATAGAACAGATGATGAATGAATGCAAGGAGTCACAGGCAGTTAAGACAGCCGAGCATGGGAGCG
TGTTAATCTGCACCAATCTTTCCGGGCAGGACATCCGTTTCGAAATTTATCATTCAATGATAAGAAAAAGAGTGGATGGT
AAAGGGCATGTTCCGATTTTAGATCATATTACTGCCATGAAAGCTGATTTTGAAAATGGTGTTGTTTTGCTGAAAATTGA
GAGTGAGGACCAAAAAGTGTATCAAACTGCTTTTCCAGTCTATTCGTATTTAGGAGGGGGGTGA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGF Bacillus subtilis subsp. subtilis str. 168

97.638

100

0.976