Detailed information    

insolico Bioinformatically predicted

Overview

Name   sinI   Type   Regulator
Locus tag   HR084_RS12345 Genome accession   NZ_CP054177
Coordinates   2444692..2444865 (+) Length   57 a.a.
NCBI ID   WP_003230187.1    Uniprot ID   A0A063X7W9
Organism   Bacillus subtilis strain JCL16     
Function   inhibit the expression of sinR (predicted from homology)   
Competence regulation

Genomic Context

Location: 2439692..2449865
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  HR084_RS12330 (HR084_12330) gcvT 2440491..2441579 (-) 1089 WP_173614183.1 glycine cleavage system aminomethyltransferase GcvT -
  HR084_RS12335 (HR084_12335) hepAA 2442021..2443694 (+) 1674 WP_173614184.1 SNF2-related protein -
  HR084_RS12340 (HR084_12340) yqhG 2443715..2444509 (+) 795 WP_003230200.1 YqhG family protein -
  HR084_RS12345 (HR084_12345) sinI 2444692..2444865 (+) 174 WP_003230187.1 anti-repressor SinI Regulator
  HR084_RS12350 (HR084_12350) sinR 2444899..2445234 (+) 336 WP_003226345.1 transcriptional regulator SinR Regulator
  HR084_RS12355 (HR084_12355) tasA 2445327..2446112 (-) 786 WP_014664586.1 biofilm matrix protein TasA -
  HR084_RS12360 (HR084_12360) sipW 2446176..2446748 (-) 573 WP_003246088.1 signal peptidase I SipW -
  HR084_RS12365 (HR084_12365) tapA 2446732..2447493 (-) 762 WP_029726724.1 amyloid fiber anchoring/assembly protein TapA -
  HR084_RS12370 (HR084_12370) yqzG 2447765..2448091 (+) 327 WP_003246051.1 YqzG/YhdC family protein -
  HR084_RS12375 (HR084_12375) spoIITA 2448133..2448312 (-) 180 WP_029726723.1 YqzE family protein -
  HR084_RS12380 (HR084_12380) comGG 2448384..2448758 (-) 375 WP_029726722.1 ComG operon protein ComGG Machinery gene
  HR084_RS12385 (HR084_12385) comGF 2448759..2449142 (-) 384 WP_029317913.1 ComG operon protein ComGF Machinery gene
  HR084_RS12390 (HR084_12390) comGE 2449168..2449515 (-) 348 WP_014480255.1 ComG operon protein 5 Machinery gene

Sequence

Protein


Download         Length: 57 a.a.        Molecular weight: 6601.52 Da        Isoelectric Point: 6.7231

>NTDB_id=451329 HR084_RS12345 WP_003230187.1 2444692..2444865(+) (sinI) [Bacillus subtilis strain JCL16]
MKNAKQEHFELDQEWVELMVEAKEANISPEEIRKYLLLNKKSAHPGPAARSHTVNPF

Nucleotide


Download         Length: 174 bp        

>NTDB_id=451329 HR084_RS12345 WP_003230187.1 2444692..2444865(+) (sinI) [Bacillus subtilis strain JCL16]
ATGAAGAATGCAAAACAAGAGCACTTTGAATTGGATCAAGAATGGGTTGAATTAATGGTGGAAGCCAAAGAGGCAAATAT
CAGCCCGGAAGAAATACGAAAATATTTACTTTTAAACAAAAAGTCTGCTCATCCTGGTCCGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA

Domains

Predicted by InterproScan.

Anti-repressor SinI (SinI)

(11-36)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB A0A063X7W9

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sinI Bacillus subtilis subsp. subtilis str. 168

100

100

1