Detailed information NTG0448879

Bioinformatically predicted

Overview

• Name: comGG
• Type: Machinery gene
• Locus tag: STCNRZ887_RS08420
• Genome accession: NZ_CP065491
• Coordinates: 1637701..1638018 (-)
• Length: 105 a.a.
• NCBI ID: WP_011226623.1
• Uniprot ID: Q5M2G4
• Organism: Streptococcus thermophilus strain CNRZ887
• Function: dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology) DNA binding and uptake

Genomic Context

Location: 1632701..1643018

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
STCNRZ887_RS08390 (STCNRZ887_08390)	-	1633050..1633712 (-)	663	WP_179971686.1	type II CAAX endopeptidase family protein	-
STCNRZ887_RS08395 (STCNRZ887_08395)	-	1633815..1634263 (-)	449	Protein_1595	CAAX protease	-
STCNRZ887_RS08400	-	1634337..1634762 (-)	426	WP_041827107.1	CPBP family intramembrane glutamic endopeptidase	-
STCNRZ887_RS08405 (STCNRZ887_08405)	-	1635005..1635202 (-)	198	WP_011681682.1	helix-turn-helix transcriptional regulator	-
STCNRZ887_RS08410 (STCNRZ887_08410)	-	1635451..1636644 (-)	1194	WP_022096898.1	acetate kinase	-
STCNRZ887_RS08415 (STCNRZ887_08415)	comGH	1636700..1637656 (-)	957	WP_011226622.1	class I SAM-dependent methyltransferase	Machinery gene
STCNRZ887_RS08420 (STCNRZ887_08420)	comGG	1637701..1638018 (-)	318	WP_011226623.1	competence type IV pilus minor pilin ComGG	Machinery gene
STCNRZ887_RS08425 (STCNRZ887_08425)	comGF	1637996..1638433 (-)	438	WP_014608742.1	competence type IV pilus minor pilin ComGF	Machinery gene
STCNRZ887_RS08430 (STCNRZ887_08430)	comGE	1638417..1638710 (-)	294	WP_011226625.1	competence type IV pilus minor pilin ComGE	Machinery gene
STCNRZ887_RS08435 (STCNRZ887_08435)	comGD	1638682..1639110 (-)	429	WP_011226626.1	competence type IV pilus minor pilin ComGD	Machinery gene
STCNRZ887_RS08440 (STCNRZ887_08440)	comGC	1639070..1639396 (-)	327	WP_002946126.1	competence type IV pilus major pilin ComGC	Machinery gene
STCNRZ887_RS08445 (STCNRZ887_08445)	comGB	1639393..1640493 (-)	1101	WP_148148900.1	competence type IV pilus assembly protein ComGB	Machinery gene
STCNRZ887_RS08450 (STCNRZ887_08450)	comGA/cglA/cilD	1640375..1641316 (-)	942	WP_011226629.1	competence type IV pilus ATPase ComGA	Machinery gene
STCNRZ887_RS08455 (STCNRZ887_08455)	-	1641397..1641759 (-)	363	WP_011226630.1	DUF1033 family protein	-

Sequence

Protein

• Length: 105 a.a.
• Molecular weight: 11796.88 Da
• Isoelectric Point: 10.6334

>NTDB_id=448879 STCNRZ887_RS08420 WP_011226623.1 1637701..1638018(-) (comGG) [Streptococcus thermophilus strain CNRZ887]
MLLKKQVRGGVLLYALFMAGIFTLLLQAYLERVVASSRQNQAQIVASQSRLMAEMTMDLVDKEAGAFSFSQGTTTYEVKG
KQVIVRVASKGQIKTYRYVKKQDQK

Nucleotide

• Length: 318 bp

>NTDB_id=448879 STCNRZ887_RS08420 WP_011226623.1 1637701..1638018(-) (comGG) [Streptococcus thermophilus strain CNRZ887]
ATGCTTTTGAAAAAACAGGTTAGGGGAGGCGTTCTTCTCTACGCTCTTTTTATGGCTGGCATTTTTACACTCCTTCTTCA
GGCTTATCTGGAACGGGTGGTAGCTAGCTCTAGACAAAACCAAGCGCAAATAGTGGCCAGTCAAAGCCGTCTCATGGCAG
AGATGACTATGGACTTGGTGGATAAGGAAGCAGGTGCTTTTAGTTTTTCTCAGGGGACTACGACTTACGAGGTTAAGGGT
AAGCAAGTGATTGTCAGAGTTGCCAGTAAAGGCCAAATCAAGACCTATCGTTATGTGAAGAAACAAGATCAGAAATAG

Domains

No domain identified.

3D structure

• AlphaFold DB: Q5M2G4

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	Ha-value
comGG	Streptococcus mutans UA140	45.455	94.286	0.429
comGG	Streptococcus mutans UA159	45.455	94.286	0.429
comGG/cglG	Streptococcus pneumoniae Rx1	42.222	85.714	0.362
comGG/cglG	Streptococcus pneumoniae D39	42.222	85.714	0.362
comGG/cglG	Streptococcus pneumoniae R6	42.222	85.714	0.362
comGG/cglG	Streptococcus pneumoniae TIGR4	42.222	85.714	0.362