Detailed information    

insolico Bioinformatically predicted

Overview

Name   sinI   Type   Regulator
Locus tag   HNV93_RS00620 Genome accession   NZ_CP053717
Coordinates   99403..99576 (-) Length   57 a.a.
NCBI ID   WP_032874029.1    Uniprot ID   -
Organism   Bacillus velezensis strain A2     
Function   inhibit the expression of sinR (predicted from homology)   
Competence regulation

Genomic Context

Location: 94403..104576
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  HNV93_RS00570 comGD 94522..94959 (+) 438 WP_007612572.1 competence type IV pilus minor pilin ComGD Machinery gene
  HNV93_RS00575 comGE 94943..95257 (+) 315 WP_032874016.1 competence type IV pilus minor pilin ComGE Machinery gene
  HNV93_RS00580 comGF 95166..95666 (+) 501 WP_223204419.1 competence type IV pilus minor pilin ComGF -
  HNV93_RS00585 comGG 95667..96044 (+) 378 WP_032874019.1 competence type IV pilus minor pilin ComGG Machinery gene
  HNV93_RS00590 - 96101..96280 (+) 180 WP_022552966.1 YqzE family protein -
  HNV93_RS00595 - 96321..96650 (-) 330 WP_032874021.1 DUF3889 domain-containing protein -
  HNV93_RS00600 tapA 96909..97580 (+) 672 WP_032874023.1 amyloid fiber anchoring/assembly protein TapA -
  HNV93_RS00605 sipW 97552..98136 (+) 585 WP_032874025.1 signal peptidase I SipW -
  HNV93_RS00610 tasA 98201..98986 (+) 786 WP_032874027.1 biofilm matrix protein TasA -
  HNV93_RS00615 sinR 99034..99369 (-) 336 WP_003153104.1 transcriptional regulator SinR Regulator
  HNV93_RS00620 sinI 99403..99576 (-) 174 WP_032874029.1 anti-repressor SinI Regulator
  HNV93_RS00625 - 99753..100547 (-) 795 WP_007612541.1 YqhG family protein -
  HNV93_RS00630 - 100569..102239 (-) 1671 WP_032874031.1 DEAD/DEAH box helicase -
  HNV93_RS00635 gcvT 102662..103762 (+) 1101 WP_032874033.1 glycine cleavage system aminomethyltransferase GcvT -

Sequence

Protein


Download         Length: 57 a.a.        Molecular weight: 6658.66 Da        Isoelectric Point: 9.8168

>NTDB_id=446550 HNV93_RS00620 WP_032874029.1 99403..99576(-) (sinI) [Bacillus velezensis strain A2]
MKNAKMEFSQLDKEWVELILEAQKANISLEEIRKYLLSNKKSSQHVQAARSHTVNPF

Nucleotide


Download         Length: 174 bp        

>NTDB_id=446550 HNV93_RS00620 WP_032874029.1 99403..99576(-) (sinI) [Bacillus velezensis strain A2]
ATGAAAAATGCAAAAATGGAATTTTCGCAATTAGATAAGGAATGGGTTGAGCTGATATTAGAAGCCCAAAAAGCAAATAT
CAGCCTAGAAGAAATACGCAAATACCTGCTTTCGAATAAAAAGTCTTCTCAACATGTCCAGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA

Domains

Predicted by InterproScan.

Anti-repressor SinI (SinI)

(11-37)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sinI Bacillus subtilis subsp. subtilis str. 168

71.93

100

0.719