Detailed information    

insolico Bioinformatically predicted

Overview


Name   comGG   Type   Machinery gene
Locus tag   HNV93_RS00585 Genome accession   NZ_CP053717
Coordinates   95667..96044 (+) Length   125 a.a.
NCBI ID   WP_032874019.1    Uniprot ID   -
Organism   Bacillus velezensis strain A2     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 90667..101044
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  HNV93_RS00550 - 90978..91928 (+) 951 WP_032874012.1 magnesium transporter CorA family protein -
  HNV93_RS00555 comGA 92125..93195 (+) 1071 WP_003153083.1 competence type IV pilus ATPase ComGA Machinery gene
  HNV93_RS00560 comGB 93182..94219 (+) 1038 WP_032874014.1 competence type IV pilus assembly protein ComGB Machinery gene
  HNV93_RS00565 comGC 94224..94532 (+) 309 WP_003153087.1 competence type IV pilus major pilin ComGC Machinery gene
  HNV93_RS00570 comGD 94522..94959 (+) 438 WP_007612572.1 competence type IV pilus minor pilin ComGD Machinery gene
  HNV93_RS00575 comGE 94943..95257 (+) 315 WP_032874016.1 competence type IV pilus minor pilin ComGE Machinery gene
  HNV93_RS00580 comGF 95166..95666 (+) 501 WP_223204419.1 competence type IV pilus minor pilin ComGF -
  HNV93_RS00585 comGG 95667..96044 (+) 378 WP_032874019.1 competence type IV pilus minor pilin ComGG Machinery gene
  HNV93_RS00590 - 96101..96280 (+) 180 WP_022552966.1 YqzE family protein -
  HNV93_RS00595 - 96321..96650 (-) 330 WP_032874021.1 DUF3889 domain-containing protein -
  HNV93_RS00600 tapA 96909..97580 (+) 672 WP_032874023.1 amyloid fiber anchoring/assembly protein TapA -
  HNV93_RS00605 sipW 97552..98136 (+) 585 WP_032874025.1 signal peptidase I SipW -
  HNV93_RS00610 tasA 98201..98986 (+) 786 WP_032874027.1 biofilm matrix protein TasA -
  HNV93_RS00615 sinR 99034..99369 (-) 336 WP_003153104.1 transcriptional regulator SinR Regulator
  HNV93_RS00620 sinI 99403..99576 (-) 174 WP_032874029.1 anti-repressor SinI Regulator
  HNV93_RS00625 - 99753..100547 (-) 795 WP_007612541.1 YqhG family protein -

Sequence


Protein


Download         Length: 125 a.a.        Molecular weight: 14077.01 Da        Isoelectric Point: 10.2236

>NTDB_id=446548 HNV93_RS00585 WP_032874019.1 95667..96044(+) (comGG) [Bacillus velezensis strain A2]
MSKSDGFIYPAVLFVSAAVLLVISYTSSDFITRKTFAKEAGEYWIGENLLQNGALLSSRHMAQGKKARTGTQRFPYGTVS
FHISGSDRRETVQVTIQTETTTGTRREAHLLFDQKKKQLIQWTEV

Nucleotide


Download         Length: 378 bp        

>NTDB_id=446548 HNV93_RS00585 WP_032874019.1 95667..96044(+) (comGG) [Bacillus velezensis strain A2]
ATGTCCAAATCTGACGGTTTTATATATCCCGCGGTTCTGTTTGTTTCTGCCGCAGTTTTACTTGTCATCAGCTATACTTC
ATCTGATTTCATCACCCGAAAAACATTTGCAAAAGAGGCAGGGGAGTACTGGATCGGAGAGAACCTGCTCCAAAACGGCG
CGCTGCTGTCAAGCCGCCATATGGCACAGGGAAAAAAGGCCCGAACTGGTACACAGCGTTTTCCGTATGGCACCGTTTCT
TTTCACATCTCCGGGAGTGATCGCCGGGAAACGGTTCAGGTTACAATTCAGACGGAAACCACGACAGGTACGAGACGGGA
GGCTCACCTTTTGTTCGATCAGAAGAAGAAACAGCTGATTCAATGGACGGAAGTATAA

Domains


Predicted by InterProScan.

(30-124)


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGG Bacillus subtilis subsp. subtilis str. 168

49.194

99.2

0.488