Detailed information    

insolico Bioinformatically predicted

Overview


Name   comGG   Type   Machinery gene
Locus tag   BANAU_RS12925 Genome accession   NC_017061
Coordinates   2668860..2669237 (-) Length   125 a.a.
NCBI ID   WP_014418373.1    Uniprot ID   I2C7P9
Organism   Bacillus velezensis YAU B9601-Y2     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 2663860..2674237
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  BANAU_RS12885 (BANAU_2444) - 2664357..2665151 (+) 795 WP_014418368.1 YqhG family protein -
  BANAU_RS12890 (BANAU_2445) sinI 2665328..2665501 (+) 174 WP_014418369.1 anti-repressor SinI Regulator
  BANAU_RS12895 (BANAU_2446) sinR 2665535..2665870 (+) 336 WP_003153104.1 transcriptional regulator SinR Regulator
  BANAU_RS12900 (BANAU_2447) tasA 2665918..2666703 (-) 786 WP_007408329.1 biofilm matrix protein TasA -
  BANAU_RS12905 (BANAU_2448) sipW 2666768..2667352 (-) 585 WP_014418370.1 signal peptidase I SipW -
  BANAU_RS12910 (BANAU_2449) tapA 2667324..2667995 (-) 672 WP_014418371.1 amyloid fiber anchoring/assembly protein TapA -
  BANAU_RS12915 (BANAU_2450) - 2668254..2668583 (+) 330 WP_014418372.1 DUF3889 domain-containing protein -
  BANAU_RS12920 (BANAU_2451) - 2668624..2668803 (-) 180 WP_003153093.1 YqzE family protein -
  BANAU_RS12925 (BANAU_2452) comGG 2668860..2669237 (-) 378 WP_014418373.1 competence type IV pilus minor pilin ComGG Machinery gene
  BANAU_RS12930 (BANAU_2453) comGF 2669238..2669633 (-) 396 WP_014721501.1 competence type IV pilus minor pilin ComGF -
  BANAU_RS12935 (BANAU_2454) comGE 2669647..2669961 (-) 315 WP_032863566.1 competence type IV pilus minor pilin ComGE Machinery gene
  BANAU_RS12940 (BANAU_2455) comGD 2669945..2670382 (-) 438 WP_007612572.1 competence type IV pilus minor pilin ComGD Machinery gene
  BANAU_RS12945 (BANAU_2456) comGC 2670372..2670638 (-) 267 WP_050496152.1 competence type IV pilus major pilin ComGC Machinery gene
  BANAU_RS12950 (BANAU_2457) comGB 2670685..2671722 (-) 1038 WP_014418377.1 competence type IV pilus assembly protein ComGB Machinery gene
  BANAU_RS12955 (BANAU_2458) comGA 2671709..2672779 (-) 1071 WP_014418378.1 competence type IV pilus ATPase ComGA Machinery gene
  BANAU_RS12960 (BANAU_2459) - 2672972..2673922 (-) 951 WP_014418379.1 magnesium transporter CorA family protein -

Sequence


Protein


Download         Length: 125 a.a.        Molecular weight: 14119.10 Da        Isoelectric Point: 9.9337

>NTDB_id=44620 BANAU_RS12925 WP_014418373.1 2668860..2669237(-) (comGG) [Bacillus velezensis YAU B9601-Y2]
MYKSDGFIYPAVLFVSAAVLLVISYTSSDFITRKTFAKEAGEYWIGENLLQNGALLSSRHMTQGQKGQTGTQRFPYGTVS
FHITGSDRRETVKVTIQAETMTGTRREATLLFDQKKKQLIQWTEV

Nucleotide


Download         Length: 378 bp        

>NTDB_id=44620 BANAU_RS12925 WP_014418373.1 2668860..2669237(-) (comGG) [Bacillus velezensis YAU B9601-Y2]
ATGTACAAATCTGACGGTTTTATATATCCCGCGGTTCTGTTTGTTTCTGCCGCAGTTTTACTTGTCATCAGCTATACTTC
ATCTGATTTCATCACCCGAAAAACATTTGCAAAAGAGGCCGGGGAGTACTGGATCGGAGAGAACCTGCTCCAAAACGGCG
CGCTGCTGTCAAGCCGCCATATGACACAGGGACAAAAGGGCCAAACTGGTACACAGCGTTTTCCGTACGGCACCGTTTCT
TTTCACATCACCGGGAGTGATCGCCGGGAAACGGTTAAGGTTACAATTCAGGCGGAAACCATGACAGGCACGAGACGGGA
GGCTACCCTTTTGTTCGATCAGAAGAAGAAACAGCTGATTCAATGGACGGAAGTATAA

Domains


Predicted by InterproScan.

(30-124)


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB I2C7P9

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGG Bacillus subtilis subsp. subtilis str. 168

51.613

99.2

0.512


Multiple sequence alignment