Detailed information
Overview
| Name | sinI | Type | Regulator |
| Locus tag | BANAU_RS12890 | Genome accession | NC_017061 |
| Coordinates | 2665328..2665501 (+) | Length | 57 a.a. |
| NCBI ID | WP_014418369.1 | Uniprot ID | I2C7P2 |
| Organism | Bacillus velezensis YAU B9601-Y2 | ||
| Function | inhibit the expression of sinR (predicted from homology) Competence regulation |
||
Genomic Context
Location: 2660328..2670501
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| BANAU_RS12875 (BANAU_2442) | gcvT | 2661141..2662241 (-) | 1101 | WP_014418366.1 | glycine cleavage system aminomethyltransferase GcvT | - |
| BANAU_RS12880 (BANAU_2443) | - | 2662665..2664335 (+) | 1671 | WP_021494309.1 | DEAD/DEAH box helicase | - |
| BANAU_RS12885 (BANAU_2444) | - | 2664357..2665151 (+) | 795 | WP_014418368.1 | YqhG family protein | - |
| BANAU_RS12890 (BANAU_2445) | sinI | 2665328..2665501 (+) | 174 | WP_014418369.1 | anti-repressor SinI | Regulator |
| BANAU_RS12895 (BANAU_2446) | sinR | 2665535..2665870 (+) | 336 | WP_003153104.1 | transcriptional regulator SinR | Regulator |
| BANAU_RS12900 (BANAU_2447) | tasA | 2665918..2666703 (-) | 786 | WP_007408329.1 | biofilm matrix protein TasA | - |
| BANAU_RS12905 (BANAU_2448) | sipW | 2666768..2667352 (-) | 585 | WP_014418370.1 | signal peptidase I SipW | - |
| BANAU_RS12910 (BANAU_2449) | tapA | 2667324..2667995 (-) | 672 | WP_014418371.1 | amyloid fiber anchoring/assembly protein TapA | - |
| BANAU_RS12915 (BANAU_2450) | - | 2668254..2668583 (+) | 330 | WP_014418372.1 | DUF3889 domain-containing protein | - |
| BANAU_RS12920 (BANAU_2451) | - | 2668624..2668803 (-) | 180 | WP_003153093.1 | YqzE family protein | - |
| BANAU_RS12925 (BANAU_2452) | comGG | 2668860..2669237 (-) | 378 | WP_014418373.1 | competence type IV pilus minor pilin ComGG | Machinery gene |
| BANAU_RS12930 (BANAU_2453) | comGF | 2669238..2669633 (-) | 396 | WP_014721501.1 | competence type IV pilus minor pilin ComGF | - |
| BANAU_RS12935 (BANAU_2454) | comGE | 2669647..2669961 (-) | 315 | WP_032863566.1 | competence type IV pilus minor pilin ComGE | Machinery gene |
| BANAU_RS12940 (BANAU_2455) | comGD | 2669945..2670382 (-) | 438 | WP_007612572.1 | competence type IV pilus minor pilin ComGD | Machinery gene |
Sequence
Protein
Download Length: 57 a.a. Molecular weight: 6642.60 Da Isoelectric Point: 9.8168
>NTDB_id=44618 BANAU_RS12890 WP_014418369.1 2665328..2665501(+) (sinI) [Bacillus velezensis YAU B9601-Y2]
MKNAKTEFSQLDKEWVELILEAQKANISLEEIRKYLLSNKKSSQHIQAARSHTVNPF
MKNAKTEFSQLDKEWVELILEAQKANISLEEIRKYLLSNKKSSQHIQAARSHTVNPF
Nucleotide
Download Length: 174 bp
>NTDB_id=44618 BANAU_RS12890 WP_014418369.1 2665328..2665501(+) (sinI) [Bacillus velezensis YAU B9601-Y2]
ATGAAAAATGCAAAAACAGAATTTTCGCAATTAGATAAGGAATGGGTTGAGCTGATATTAGAAGCCCAAAAAGCAAATAT
CAGCCTAGAAGAAATACGCAAATACCTGCTTTCGAATAAAAAGTCTTCTCAACATATCCAGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA
ATGAAAAATGCAAAAACAGAATTTTCGCAATTAGATAAGGAATGGGTTGAGCTGATATTAGAAGCCCAAAAAGCAAATAT
CAGCCTAGAAGAAATACGCAAATACCTGCTTTCGAATAAAAAGTCTTCTCAACATATCCAGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| sinI | Bacillus subtilis subsp. subtilis str. 168 |
71.93 |
100 |
0.719 |