Detailed information    

insolico Bioinformatically predicted

Overview


Name   ctsR   Type   Machinery gene
Locus tag   HPE59_RS07480 Genome accession   NZ_CP053659
Coordinates   1454087..1454398 (-) Length   103 a.a.
NCBI ID   WP_015016496.1    Uniprot ID   A0A3X8SVA4
Organism   Campylobacter jejuni strain 2016-IZSVE-19-111250     
Function   type II secretion system/type IV pilin; DNA uptake (predicted from homology)   
DNA binding and uptake

Related MGE


Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
Prophage 1408745..1454398 1454087..1454398 within 0


Gene organization within MGE regions


Location: 1408745..1454398
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  HPE59_RS07160 (HPE59_07165) - 1408745..1409176 (+) 432 Protein_1402 DUF2400 family protein -
  HPE59_RS07165 (HPE59_07170) - 1409270..1409971 (-) 702 WP_052778344.1 hypothetical protein -
  HPE59_RS07170 (HPE59_07175) - 1409971..1410645 (-) 675 WP_002791430.1 S24 family peptidase -
  HPE59_RS07175 (HPE59_07180) - 1410795..1410995 (+) 201 WP_002826948.1 hypothetical protein -
  HPE59_RS07180 (HPE59_07185) - 1410992..1413067 (+) 2076 WP_032593272.1 DDE-type integrase/transposase/recombinase -
  HPE59_RS07185 (HPE59_07190) - 1413138..1414061 (+) 924 WP_052778345.1 AAA family ATPase -
  HPE59_RS07190 (HPE59_07195) - 1414064..1414255 (+) 192 WP_171849138.1 sigma factor-like helix-turn-helix DNA-binding protein -
  HPE59_RS07195 (HPE59_07200) - 1414252..1414437 (+) 186 WP_002824157.1 hypothetical protein -
  HPE59_RS07200 (HPE59_07205) - 1414494..1414835 (+) 342 WP_002791419.1 DUF4406 domain-containing protein -
  HPE59_RS07205 (HPE59_07210) - 1414942..1415427 (+) 486 WP_052782897.1 host-nuclease inhibitor Gam family protein -
  HPE59_RS07210 (HPE59_07215) - 1415424..1415609 (+) 186 WP_002824160.1 hypothetical protein -
  HPE59_RS07215 (HPE59_07220) - 1415673..1415945 (+) 273 WP_002791414.1 hypothetical protein -
  HPE59_RS07220 (HPE59_07225) - 1415942..1416367 (+) 426 WP_052774289.1 YopX family protein -
  HPE59_RS07225 (HPE59_07230) - 1416476..1417438 (+) 963 WP_041160246.1 hypothetical protein -
  HPE59_RS07230 (HPE59_07235) - 1417435..1417704 (+) 270 WP_002784531.1 hypothetical protein -
  HPE59_RS07235 (HPE59_07240) - 1417704..1418396 (+) 693 WP_041160245.1 hypothetical protein -
  HPE59_RS07240 (HPE59_07245) - 1418393..1418842 (+) 450 WP_002876315.1 regulatory protein GemA -
  HPE59_RS07245 (HPE59_07250) - 1418889..1419164 (+) 276 WP_002873721.1 hypothetical protein -
  HPE59_RS07250 (HPE59_07255) - 1419156..1419827 (-) 672 WP_100620450.1 endonuclease -
  HPE59_RS07255 (HPE59_07260) - 1419921..1420205 (+) 285 WP_052778348.1 Mor transcription activator family protein -
  HPE59_RS07260 (HPE59_07265) - 1420202..1421179 (-) 978 WP_002852060.1 tail protein -
  HPE59_RS07265 (HPE59_07270) - 1421173..1421364 (-) 192 WP_002784520.1 tail protein X -
  HPE59_RS07270 (HPE59_07275) - 1421357..1421731 (-) 375 WP_002876309.1 phage tail protein -
  HPE59_RS07275 (HPE59_07280) - 1421857..1423095 (-) 1239 WP_171849139.1 phage minor head protein -
  HPE59_RS07280 (HPE59_07285) - 1423097..1424467 (-) 1371 WP_002872709.1 DUF935 family protein -
  HPE59_RS07285 (HPE59_07290) terL 1424477..1426147 (-) 1671 WP_038401728.1 phage terminase large subunit -
  HPE59_RS07290 (HPE59_07295) - 1426147..1426746 (-) 600 WP_002803360.1 DUF1804 family protein -
  HPE59_RS07295 (HPE59_07300) - 1426739..1427197 (-) 459 WP_002855185.1 phage protein Gp36 family protein -
  HPE59_RS07300 (HPE59_07305) - 1427312..1428289 (-) 978 WP_002865469.1 major capsid protein -
  HPE59_RS07305 (HPE59_07310) - 1428292..1428819 (-) 528 WP_002784505.1 hypothetical protein -
  HPE59_RS07310 (HPE59_07315) - 1428822..1429637 (-) 816 WP_052798387.1 phage protease -
  HPE59_RS07315 (HPE59_07320) - 1429639..1430073 (-) 435 WP_002784501.1 hypothetical protein -
  HPE59_RS07320 (HPE59_07325) - 1430221..1430610 (+) 390 WP_052798388.1 D-Ala-D-Ala carboxypeptidase family metallohydrolase -
  HPE59_RS07325 (HPE59_07330) - 1430621..1430962 (+) 342 WP_002876558.1 hypothetical protein -
  HPE59_RS07330 (HPE59_07335) - 1430959..1431207 (+) 249 WP_052798389.1 hypothetical protein -
  HPE59_RS07335 (HPE59_07340) - 1431319..1431633 (+) 315 WP_052778349.1 phage holin family protein -
  HPE59_RS07340 (HPE59_07345) - 1431633..1432265 (+) 633 WP_052777356.1 phage baseplate assembly protein V -
  HPE59_RS07345 (HPE59_07350) - 1432274..1432465 (+) 192 WP_002795238.1 hypothetical protein -
  HPE59_RS07350 (HPE59_07355) - 1432462..1432752 (+) 291 WP_052784877.1 GPW/gp25 family protein -
  HPE59_RS07355 (HPE59_07360) - 1432749..1433915 (+) 1167 WP_052798390.1 baseplate J/gp47 family protein -
  HPE59_RS07360 (HPE59_07365) - 1433912..1434532 (+) 621 WP_002855112.1 phage tail protein I -
  HPE59_RS07365 (HPE59_07370) - 1434532..1435563 (+) 1032 WP_171849140.1 phage tail protein -
  HPE59_RS07370 (HPE59_07375) - 1435588..1436094 (+) 507 WP_002855083.1 DUF4376 domain-containing protein -
  HPE59_RS07375 (HPE59_07380) - 1436091..1436462 (+) 372 WP_002938257.1 DUF1353 domain-containing protein -
  HPE59_RS07380 (HPE59_07385) - 1436561..1437568 (+) 1008 WP_171849141.1 hypothetical protein -
  HPE59_RS07385 (HPE59_07390) - 1437587..1438780 (+) 1194 WP_052778352.1 phage tail sheath family protein -
  HPE59_RS07390 (HPE59_07395) - 1438807..1439316 (+) 510 WP_002865376.1 phage major tail tube protein -
  HPE59_RS07395 (HPE59_07400) - 1439469..1439708 (+) 240 WP_002843342.1 phage tail assembly protein -
  HPE59_RS07400 (HPE59_07405) - 1439820..1440125 (-) 306 WP_002791365.1 hypothetical protein -
  HPE59_RS07405 (HPE59_07410) - 1440167..1442389 (+) 2223 WP_041160232.1 phage tail tape measure protein -
  HPE59_RS07410 (HPE59_07415) - 1442393..1442881 (+) 489 WP_052778353.1 phage virion morphogenesis protein -
  HPE59_RS07415 (HPE59_07420) - 1442986..1443801 (+) 816 WP_002870153.1 DNA adenine methylase -
  HPE59_RS07420 (HPE59_07425) - 1443829..1444116 (-) 288 WP_002865289.1 hypothetical protein -
  HPE59_RS07425 (HPE59_07430) - 1444196..1444390 (-) 195 WP_002843339.1 hypothetical protein -
  HPE59_RS07430 (HPE59_07435) - 1444400..1444720 (-) 321 WP_038400980.1 hypothetical protein -
  HPE59_RS07435 (HPE59_07440) - 1444801..1445430 (-) 630 WP_052778354.1 S24 family peptidase -
  HPE59_RS07440 (HPE59_07445) - 1445515..1447230 (-) 1716 WP_052778355.1 P-loop NTPase fold protein -
  HPE59_RS07445 (HPE59_07450) - 1447676..1448017 (+) 342 Protein_1459 TIGR02757 family protein -
  HPE59_RS07450 (HPE59_07455) - 1448021..1448785 (+) 765 WP_002851426.1 TSUP family transporter -
  HPE59_RS07455 (HPE59_07460) ctsF 1448778..1449959 (-) 1182 WP_002851165.1 type II secretion system F family protein Machinery gene
  HPE59_RS07460 (HPE59_07465) ctsE 1449956..1451515 (-) 1560 WP_002864463.1 GspE/PulE family protein Machinery gene
  HPE59_RS07465 (HPE59_07470) ctsX 1451505..1452092 (-) 588 WP_002851370.1 membrane protein Machinery gene
  HPE59_RS07470 (HPE59_07475) ctsP 1452096..1452704 (-) 609 WP_002851464.1 ATP-binding protein Machinery gene
  HPE59_RS07475 (HPE59_07480) ctsD 1452697..1454109 (-) 1413 WP_002862130.1 pilus (MSHA type) biogenesis protein MshL Machinery gene
  HPE59_RS07480 (HPE59_07485) ctsR 1454087..1454398 (-) 312 WP_015016496.1 hypothetical protein Machinery gene

Sequence


Protein


Download         Length: 103 a.a.        Molecular weight: 12457.35 Da        Isoelectric Point: 5.8722

>NTDB_id=446062 HPE59_RS07480 WP_015016496.1 1454087..1454398(-) (ctsR) [Campylobacter jejuni strain 2016-IZSVE-19-111250]
MCFSTLFAQDNFEEYFKLIDKENRINFNTLQNPFVNPTFEKLRHIKITAIILDKVKIYDRWYKKGDMIDDAIIYEINTKE
IKFQYDNLEIAIQINKNDKININ

Nucleotide


Download         Length: 312 bp        

>NTDB_id=446062 HPE59_RS07480 WP_015016496.1 1454087..1454398(-) (ctsR) [Campylobacter jejuni strain 2016-IZSVE-19-111250]
TTGTGTTTTAGCACTTTGTTTGCACAAGATAATTTTGAAGAGTATTTTAAACTTATAGATAAAGAAAATCGTATAAATTT
TAATACTCTTCAAAACCCATTTGTGAATCCTACTTTTGAAAAATTAAGACATATTAAAATTACTGCAATTATACTTGATA
AAGTAAAAATTTATGATCGATGGTATAAAAAAGGTGATATGATTGATGATGCTATAATATATGAAATAAATACTAAAGAG
ATTAAATTCCAATATGATAATTTAGAAATTGCAATCCAAATAAATAAAAATGATAAGATTAATATTAATTAA

Domains



No domain identified.



Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB A0A3X8SVA4

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  ctsR Campylobacter jejuni subsp. jejuni 81-176

99.029

100

0.99