NTDB

Overview

Name	comGC	Type	Machinery gene
Locus tag	EYQ96_RS07955	Genome accession	NZ_CP053477
Coordinates	1521774..1522091 (+)	Length	105 a.a.
NCBI ID	WP_023372658.1	Uniprot ID	-
Organism	Staphylococcus warneri strain WB224
Function	dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology) DNA binding and uptake

Genomic Context

Location: 1516774..1527091

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
EYQ96_RS07925 (EYQ96_07945)	-	1517565..1517768 (+)	204	WP_002451885.1	YqgQ family protein	-
EYQ96_RS07930 (EYQ96_07950)	-	1517765..1518751 (+)	987	WP_023372667.1	ROK family glucokinase	-
EYQ96_RS07935 (EYQ96_07955)	-	1518751..1519074 (+)	324	WP_023372665.1	MTH1187 family thiamine-binding protein	-
EYQ96_RS07940 (EYQ96_07960)	-	1519078..1519701 (+)	624	WP_023372663.1	MBL fold metallo-hydrolase	-
EYQ96_RS07945 (EYQ96_07965)	comGA	1519748..1520722 (+)	975	WP_023372661.1	competence type IV pilus ATPase ComGA	Machinery gene
EYQ96_RS07950 (EYQ96_07970)	comGB	1520694..1521761 (+)	1068	WP_114599431.1	competence type IV pilus assembly protein ComGB	-
EYQ96_RS07955 (EYQ96_07975)	comGC	1521774..1522091 (+)	318	WP_023372658.1	competence type IV pilus major pilin ComGC	Machinery gene
EYQ96_RS07960 (EYQ96_07980)	comGD	1522069..1522509 (+)	441	WP_041613568.1	competence type IV pilus minor pilin ComGD	Machinery gene
EYQ96_RS07965 (EYQ96_07985)	-	1522743..1523204 (+)	462	WP_231307184.1	hypothetical protein	-
EYQ96_RS07970 (EYQ96_07990)	-	1523363..1523881 (+)	519	WP_023372652.1	shikimate kinase	-
EYQ96_RS07975 (EYQ96_07995)	gcvT	1524054..1525145 (+)	1092	WP_023372650.1	glycine cleavage system aminomethyltransferase GcvT	-
EYQ96_RS07980 (EYQ96_08000)	gcvPA	1525164..1526513 (+)	1350	WP_041613564.1	aminomethyl-transferring glycine dehydrogenase subunit GcvPA	-

Sequence

Protein

Download Length: 105 a.a. Molecular weight: 11612.58 Da Isoelectric Point: 8.5106

                                >NTDB_id=444934 EYQ96_RS07955 WP_023372658.1 1521774..1522091(+) (comGC) [Staphylococcus warneri strain WB224]

MIKPNHSFKTKAFTLIEMLLVLLIISLLLILIIPNVAKQTANIQSTGCDAQVKMINSQIEAYSLKHNRNPNTIQDLITEG

YIKENQKSCKTGETISISNGEAIAN

Nucleotide

Download Length: 318 bp

                                >NTDB_id=444934 EYQ96_RS07955 WP_023372658.1 1521774..1522091(+) (comGC) [Staphylococcus warneri strain WB224]

ATGATAAAACCCAATCACTCATTTAAAACTAAAGCTTTCACCTTAATCGAAATGCTTTTAGTATTATTAATAATTAGTTT

ATTACTCATTTTAATTATACCTAATGTCGCCAAACAAACGGCTAATATACAATCAACAGGCTGCGACGCACAAGTTAAAA

TGATTAATAGTCAAATTGAAGCCTATTCTTTAAAACATAATAGAAACCCAAATACGATACAGGATTTAATTACGGAAGGA

TATATTAAAGAGAATCAAAAAAGTTGTAAAACAGGTGAAACTATTTCAATTAGTAATGGCGAAGCGATTGCAAATTAA

Domains

Predicted by InterproScan.

Prokaryotic N-terminal methylation motif (N_methyl)

(9-32)

Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.

3D structure

Source	ID	Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.

Visualization of predicted probability:

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	H_a-value
comGC	Staphylococcus aureus MW2	82.474	92.381	0.762
comGC	Staphylococcus aureus N315	82.474	92.381	0.762
comYC	Streptococcus gordonii str. Challis substr. CH1	42.424	94.286	0.4
comGC/cglC	Streptococcus pneumoniae TIGR4	43.617	89.524	0.39
comYC	Streptococcus suis isolate S10	50	76.19	0.381
comGC	Bacillus subtilis subsp. subtilis str. 168	43.956	86.667	0.381
comGC/cglC	Streptococcus mitis NCTC 12261	48.718	74.286	0.362
comGC/cglC	Streptococcus mitis SK321	48.718	74.286	0.362

Detailed information NTG0444934