Detailed information    

insolico Bioinformatically predicted

Overview

Name   cipB   Type   Regulator
Locus tag   HKM25_RS02605 Genome accession   NZ_CP053210
Coordinates   501886..502035 (+) Length   49 a.a.
NCBI ID   WP_001809846.1    Uniprot ID   Q00MV6
Organism   Streptococcus pneumoniae strain 6A-10     
Function   indirect induction of ComX; activation of comRS system (predicted from homology)   
Competence regulation

Genomic Context

Location: 496886..507035
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  HKM25_RS02580 blpC 497150..497305 (-) 156 WP_000358814.1 quorum-sensing system pheromone BlpC -
  HKM25_RS02585 (HKM25_525) - 497362..498723 (-) 1362 WP_001069099.1 bacteriocin secretion accessory protein -
  HKM25_RS02590 (HKM25_526) comA/nlmT 498734..500887 (-) 2154 WP_000205152.1 peptide cleavage/export ABC transporter BlpA Regulator
  HKM25_RS02595 (HKM25_527) blpM 501169..501423 (+) 255 WP_001093255.1 two-peptide bacteriocin subunit BlpM -
  HKM25_RS02600 (HKM25_528) blpN 501439..501642 (+) 204 WP_001099490.1 two-peptide bacteriocin subunit BlpN -
  HKM25_RS02605 (HKM25_529) cipB 501886..502035 (+) 150 WP_001809846.1 bacteriocin-like peptide BlpO Regulator
  HKM25_RS02610 (HKM25_531) - 502139..502258 (+) 120 WP_001829206.1 PncF family bacteriocin immunity protein -
  HKM25_RS11995 - 502947..503943 (+) 997 Protein_522 thioredoxin domain-containing protein -
  HKM25_RS12000 - 504400..504593 (+) 194 Protein_523 hypothetical protein -
  HKM25_RS02625 (HKM25_535) - 504676..505095 (+) 420 WP_000877382.1 hypothetical protein -
  HKM25_RS02630 (HKM25_536) - 505110..505799 (+) 690 WP_000760515.1 CPBP family intramembrane glutamic endopeptidase -
  HKM25_RS02635 (HKM25_537) blpZ 505841..506089 (+) 249 WP_000276506.1 immunity protein BlpZ -
  HKM25_RS02640 (HKM25_538) - 506119..506730 (+) 612 WP_000394042.1 type II CAAX endopeptidase family protein -

Sequence

Protein


Download         Length: 49 a.a.        Molecular weight: 5149.92 Da        Isoelectric Point: 4.0439

>NTDB_id=443428 HKM25_RS02605 WP_001809846.1 501886..502035(+) (cipB) [Streptococcus pneumoniae strain 6A-10]
MNTKMMSQFSVMDNEMLACVEGGDIDWGRKISCAAGVAYGAIDGCATTV

Nucleotide


Download         Length: 150 bp        

>NTDB_id=443428 HKM25_RS02605 WP_001809846.1 501886..502035(+) (cipB) [Streptococcus pneumoniae strain 6A-10]
ATGAATACAAAAATGATGTCACAATTTTCTGTTATGGATAATGAAATGCTTGCTTGCGTTGAAGGTGGAGATATTGATTG
GGGAAGAAAAATTAGTTGTGCAGCAGGGGTTGCATATGGCGCGATTGATGGGTGTGCAACAACGGTTTGA

Domains

Predicted by InterproScan.

Bacteriocin class II with double-glycine leader peptide (Bacteriocin_IIc)

(6-44)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB Q00MV6

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  cipB Streptococcus mutans UA159

53.061

100

0.531