Detailed information    

insolico Bioinformatically predicted

Overview


Name   comGF   Type   Machinery gene
Locus tag   HIR77_RS14095 Genome accession   NZ_CP053102
Coordinates   2669518..2669901 (-) Length   127 a.a.
NCBI ID   WP_003230168.1    Uniprot ID   -
Organism   Bacillus subtilis subsp. subtilis str. 168     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 2664518..2674901
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  HIR77_RS14050 (HIR77_14070) sinI 2664808..2664981 (+) 174 WP_003230187.1 anti-repressor SinI Regulator
  HIR77_RS14055 (HIR77_14075) sinR 2665015..2665350 (+) 336 WP_003226345.1 transcriptional regulator SinR Regulator
  HIR77_RS14060 (HIR77_14080) aph(3')-IIIa 2665588..2666382 (-) 795 WP_001096887.1 aminoglycoside O-phosphotransferase APH(3')-IIIa -
  HIR77_RS14065 (HIR77_14085) - 2666475..2666964 (-) 490 Protein_2740 GNAT family N-acetyltransferase -
  HIR77_RS14070 (HIR77_14090) sipW 2666936..2667508 (-) 573 WP_003246088.1 signal peptidase I SipW -
  HIR77_RS14075 (HIR77_14095) tapA 2667492..2668253 (-) 762 WP_004399106.1 amyloid fiber anchoring/assembly protein TapA -
  HIR77_RS14080 (HIR77_14100) yqzG 2668525..2668851 (+) 327 WP_003246051.1 YqzG/YhdC family protein -
  HIR77_RS14085 (HIR77_14105) spoIITA 2668893..2669072 (-) 180 WP_003230176.1 YqzE family protein -
  HIR77_RS14090 (HIR77_14110) comGG 2669143..2669517 (-) 375 WP_003230170.1 ComG operon protein ComGG Machinery gene
  HIR77_RS14095 (HIR77_14115) comGF 2669518..2669901 (-) 384 WP_003230168.1 ComG operon protein ComGF Machinery gene
  HIR77_RS14100 (HIR77_14120) comGE 2669927..2670274 (-) 348 WP_003230165.1 ComG operon protein 5 Machinery gene
  HIR77_RS14105 (HIR77_14125) comGD 2670258..2670689 (-) 432 WP_004398628.1 comG operon protein ComGD Machinery gene
  HIR77_RS14110 (HIR77_14130) comGC 2670679..2670975 (-) 297 WP_003230162.1 comG operon protein ComGC Machinery gene
  HIR77_RS14115 (HIR77_14135) comGB 2670989..2672026 (-) 1038 WP_009967727.1 comG operon protein ComGB Machinery gene
  HIR77_RS14120 (HIR77_14140) comGA 2672013..2673083 (-) 1071 WP_004399124.1 competence protein ComGA Machinery gene
  HIR77_RS14125 (HIR77_14145) corA 2673495..2674448 (-) 954 WP_004399136.1 magnesium transporter CorA -

Sequence


Protein


Download         Length: 127 a.a.        Molecular weight: 14281.37 Da        Isoelectric Point: 5.8929

>NTDB_id=443104 HIR77_RS14095 WP_003230168.1 2669518..2669901(-) (comGF) [Bacillus subtilis subsp. subtilis str. 168]
MLISGSLAAIIHLFLSRQQEHDGFTQQEWMISIEQMMNECKESQAVKTAEHGSVLICTNLSGQDIRFDIYHSMIRKRVDG
KGHVPILDHITAMKADIENGVVLLKIESEDQKVYQTAFPVYSYLGGG

Nucleotide


Download         Length: 384 bp        

>NTDB_id=443104 HIR77_RS14095 WP_003230168.1 2669518..2669901(-) (comGF) [Bacillus subtilis subsp. subtilis str. 168]
TTGCTCATATCAGGATCGTTAGCTGCGATTATCCATCTGTTTTTGTCTCGACAGCAGGAACATGACGGTTTCACACAGCA
GGAATGGATGATTTCGATAGAACAGATGATGAATGAATGCAAGGAATCACAGGCAGTTAAGACAGCCGAGCATGGGAGCG
TGTTAATCTGCACCAATCTTTCCGGACAAGACATCCGTTTTGACATTTATCATTCAATGATAAGAAAAAGAGTGGATGGC
AAAGGGCATGTTCCGATTTTAGATCATATTACTGCCATGAAAGCTGATATTGAAAATGGTGTTGTTTTGCTGAAAATTGA
GAGTGAAGACCAAAAAGTGTATCAAACTGCTTTTCCAGTCTATTCGTATTTAGGAGGGGGGTGA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGF Bacillus subtilis subsp. subtilis str. 168

100

100

1