Detailed information    

insolico Bioinformatically predicted

Overview


Name   sinI   Type   Regulator
Locus tag   HIR77_RS14050 Genome accession   NZ_CP053102
Coordinates   2664808..2664981 (+) Length   57 a.a.
NCBI ID   WP_003230187.1    Uniprot ID   A0A063X7W9
Organism   Bacillus subtilis subsp. subtilis str. 168     
Function   inhibit the expression of sinR (predicted from homology)   
Competence regulation

Genomic Context


Location: 2659808..2669981
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  HIR77_RS14035 (HIR77_14055) gcvT 2660607..2661695 (-) 1089 WP_004398598.1 glycine cleavage system aminomethyltransferase GcvT -
  HIR77_RS14040 (HIR77_14060) hepAA 2662137..2663810 (+) 1674 WP_004398544.1 SNF2-related protein -
  HIR77_RS14045 (HIR77_14065) yqhG 2663831..2664625 (+) 795 WP_003230200.1 YqhG family protein -
  HIR77_RS14050 (HIR77_14070) sinI 2664808..2664981 (+) 174 WP_003230187.1 anti-repressor SinI Regulator
  HIR77_RS14055 (HIR77_14075) sinR 2665015..2665350 (+) 336 WP_003226345.1 transcriptional regulator SinR Regulator
  HIR77_RS14060 (HIR77_14080) aph(3')-IIIa 2665588..2666382 (-) 795 WP_001096887.1 aminoglycoside O-phosphotransferase APH(3')-IIIa -
  HIR77_RS14065 (HIR77_14085) - 2666475..2666964 (-) 490 Protein_2740 GNAT family N-acetyltransferase -
  HIR77_RS14070 (HIR77_14090) sipW 2666936..2667508 (-) 573 WP_003246088.1 signal peptidase I SipW -
  HIR77_RS14075 (HIR77_14095) tapA 2667492..2668253 (-) 762 WP_004399106.1 amyloid fiber anchoring/assembly protein TapA -
  HIR77_RS14080 (HIR77_14100) yqzG 2668525..2668851 (+) 327 WP_003246051.1 YqzG/YhdC family protein -
  HIR77_RS14085 (HIR77_14105) spoIITA 2668893..2669072 (-) 180 WP_003230176.1 YqzE family protein -
  HIR77_RS14090 (HIR77_14110) comGG 2669143..2669517 (-) 375 WP_003230170.1 ComG operon protein ComGG Machinery gene
  HIR77_RS14095 (HIR77_14115) comGF 2669518..2669901 (-) 384 WP_003230168.1 ComG operon protein ComGF Machinery gene

Sequence


Protein


Download         Length: 57 a.a.        Molecular weight: 6601.52 Da        Isoelectric Point: 6.7231

>NTDB_id=443101 HIR77_RS14050 WP_003230187.1 2664808..2664981(+) (sinI) [Bacillus subtilis subsp. subtilis str. 168]
MKNAKQEHFELDQEWVELMVEAKEANISPEEIRKYLLLNKKSAHPGPAARSHTVNPF

Nucleotide


Download         Length: 174 bp        

>NTDB_id=443101 HIR77_RS14050 WP_003230187.1 2664808..2664981(+) (sinI) [Bacillus subtilis subsp. subtilis str. 168]
ATGAAGAATGCAAAACAAGAGCACTTTGAATTGGATCAAGAATGGGTTGAATTAATGGTGGAAGCCAAAGAGGCAAATAT
CAGCCCGGAAGAAATACGAAAATATTTACTTTTAAACAAAAAGTCTGCTCATCCTGGTCCGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA

Domains


Predicted by InterproScan.

(11-36)


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB A0A063X7W9

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sinI Bacillus subtilis subsp. subtilis str. 168

100

100

1