Detailed information    

insolico Bioinformatically predicted

Overview

Name   rpoS   Type   Regulator
Locus tag   O3Y_RS02815 Genome accession   NC_016944
Coordinates   564395..565402 (+) Length   335 a.a.
NCBI ID   WP_000116737.1    Uniprot ID   O51804
Organism   Vibrio cholerae IEC224     
Function   regulation of chitinases (predicted from homology)   
Competence regulation

Related MGE

Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
Prophage 520644..576014 564395..565402 within 0


Gene organization within MGE regions


Location: 520644..576014
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  O3Y_RS02580 - 520644..522404 (-) 1761 Protein_451 GNAT family N-acyltransferase -
  O3Y_RS02590 (O3Y_02290) - 523164..525125 (-) 1962 WP_000466016.1 DUF3732 domain-containing protein -
  O3Y_RS02595 (O3Y_02295) - 525126..525638 (-) 513 WP_000917213.1 three component ABC system middle component -
  O3Y_RS02600 (O3Y_02300) - 525631..526797 (-) 1167 WP_000654528.1 ABC-three component system protein -
  O3Y_RS02605 (O3Y_02305) - 527053..527928 (-) 876 WP_001139148.1 MarR family transcriptional regulator -
  O3Y_RS02610 (O3Y_02310) - 528313..528957 (+) 645 WP_000042053.1 inovirus Gp2 family protein -
  O3Y_RS02615 (O3Y_02315) - 529019..529693 (+) 675 WP_000149629.1 inovirus Gp2 family protein -
  O3Y_RS02620 (O3Y_02320) - 529747..530346 (+) 600 WP_001883316.1 inovirus-type Gp2 protein -
  O3Y_RS02625 (O3Y_02325) - 530410..530610 (+) 201 WP_001211742.1 AlpA family transcriptional regulator -
  O3Y_RS02630 (O3Y_02330) - 530692..531132 (+) 441 WP_000122383.1 ribonuclease HI -
  O3Y_RS19220 - 531213..532404 (-) 1192 Protein_461 IS3 family transposase -
  O3Y_RS20675 - 532621..532813 (+) 193 Protein_462 RNase H family protein -
  O3Y_RS02645 - 532907..533817 (-) 911 Protein_463 IS5-like element ISVch8 family transposase -
  O3Y_RS02650 (O3Y_02365) - 534206..534730 (-) 525 WP_000042161.1 type II secretion system protein -
  O3Y_RS19225 - 535004..535228 (-) 225 WP_306461095.1 high-affinity zinc uptake system protein ZnuA precursor -
  O3Y_RS02655 (O3Y_02370) - 535426..536706 (+) 1281 WP_001883323.1 peptidoglycan DD-metalloendopeptidase family protein -
  O3Y_RS02660 (O3Y_02375) - 536884..537111 (-) 228 WP_000749780.1 hypothetical protein -
  O3Y_RS02665 (O3Y_02380) - 537159..537527 (-) 369 WP_000176666.1 hypothetical protein -
  O3Y_RS02670 (O3Y_02385) - 537558..538292 (-) 735 WP_000066832.1 WYL domain-containing protein -
  O3Y_RS02680 (O3Y_02390) - 538611..539054 (-) 444 WP_000041085.1 DUF2787 domain-containing protein -
  O3Y_RS02685 (O3Y_02395) - 539104..539541 (-) 438 WP_000572499.1 DUF2787 domain-containing protein -
  O3Y_RS02690 (O3Y_02400) radC 539538..540011 (-) 474 WP_001068472.1 DNA repair protein RadC -
  O3Y_RS02695 (O3Y_02405) - 540323..542134 (+) 1812 WP_000110139.1 DUF262 domain-containing protein -
  O3Y_RS02700 (O3Y_02410) - 542134..544599 (+) 2466 WP_000434811.1 DUF262 domain-containing protein -
  O3Y_RS02705 (O3Y_02415) - 544966..546921 (+) 1956 WP_001143868.1 hypothetical protein -
  O3Y_RS02715 (O3Y_02425) - 547228..548405 (+) 1178 WP_100068541.1 IS3 family transposase -
  O3Y_RS02720 (O3Y_02430) - 548441..549682 (-) 1242 WP_001129565.1 integrase domain-containing protein -
  O3Y_RS02730 (O3Y_02435) rpoD 550068..551945 (-) 1878 WP_000372618.1 RNA polymerase sigma factor RpoD -
  O3Y_RS02735 (O3Y_02440) dnaG 552044..553807 (-) 1764 WP_000907210.1 DNA primase -
  O3Y_RS02740 (O3Y_02445) - 553897..554340 (-) 444 WP_001173892.1 GatB/YqeY domain-containing protein -
  O3Y_RS02745 (O3Y_02450) rpsU 554370..554585 (-) 216 WP_001145625.1 30S ribosomal protein S21 -
  O3Y_RS02750 (O3Y_02455) tsaD 554826..555845 (+) 1020 WP_001220122.1 tRNA (adenosine(37)-N6)-threonylcarbamoyltransferase complex transferase subunit TsaD -
  O3Y_RS02755 (O3Y_02460) - 555999..556811 (+) 813 WP_001087495.1 alpha/beta fold hydrolase -
  O3Y_RS02760 (O3Y_02465) plsY 556860..557486 (-) 627 WP_000188027.1 glycerol-3-phosphate 1-O-acyltransferase PlsY -
  O3Y_RS02765 (O3Y_02475) folB 557675..558028 (+) 354 WP_000361954.1 bifunctional dihydroneopterin aldolase/7,8-dihydroneopterin epimerase -
  O3Y_RS02770 (O3Y_02480) folK 558025..558531 (+) 507 WP_000627006.1 2-amino-4-hydroxy-6- hydroxymethyldihydropteridine diphosphokinase -
  O3Y_RS02775 (O3Y_02485) - 558528..559331 (+) 804 WP_000119813.1 undecaprenyl-diphosphate phosphatase -
  O3Y_RS02780 (O3Y_02490) ftsB 559446..559730 (+) 285 WP_001263189.1 cell division protein FtsB -
  O3Y_RS02785 (O3Y_02495) ispD 559727..560425 (+) 699 WP_001061951.1 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase -
  O3Y_RS02790 (O3Y_02500) ispF 560422..560898 (+) 477 WP_000619209.1 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase -
  O3Y_RS02795 (O3Y_02505) truD 560928..562013 (+) 1086 WP_000129752.1 tRNA pseudouridine(13) synthase TruD -
  O3Y_RS02800 (O3Y_02510) surE 562015..562767 (+) 753 WP_000698379.1 5'/3'-nucleotidase SurE -
  O3Y_RS02805 (O3Y_02515) - 562760..563386 (+) 627 WP_000002982.1 protein-L-isoaspartate(D-aspartate) O-methyltransferase -
  O3Y_RS02810 (O3Y_02520) nlpD 563386..564321 (+) 936 WP_000177568.1 murein hydrolase activator NlpD -
  O3Y_RS02815 (O3Y_02525) rpoS 564395..565402 (+) 1008 WP_000116737.1 RNA polymerase sigma factor RpoS Regulator
  O3Y_RS02820 (O3Y_02530) mutS 565495..568083 (-) 2589 WP_001894770.1 DNA mismatch repair protein MutS -
  O3Y_RS02825 (O3Y_02535) cysM 568351..569238 (-) 888 WP_001279365.1 cysteine synthase CysM -
  O3Y_RS02830 (O3Y_02540) cysP 569622..570623 (+) 1002 WP_001079835.1 thiosulfate ABC transporter substrate-binding protein CysP -
  O3Y_RS02835 (O3Y_02545) cysT 570700..571551 (+) 852 WP_000531810.1 sulfate/thiosulfate ABC transporter permease CysT -
  O3Y_RS02840 (O3Y_02550) cysW 571562..572425 (+) 864 WP_000951362.1 sulfate ABC transporter permease subunit CysW -
  O3Y_RS02845 (O3Y_02555) - 572422..573552 (+) 1131 WP_000027776.1 sulfate/molybdate ABC transporter ATP-binding protein -
  O3Y_RS02850 (O3Y_02560) pncC 573719..574225 (+) 507 WP_000853811.1 nicotinamide-nucleotide amidase -
  O3Y_RS02855 (O3Y_02565) recA 574359..575423 (+) 1065 WP_000344154.1 recombinase RecA Machinery gene
  O3Y_RS02860 (O3Y_02570) recX 575556..576014 (+) 459 WP_000006855.1 recombination regulator RecX -

Sequence

Protein


Download         Length: 335 a.a.        Molecular weight: 38534.39 Da        Isoelectric Point: 4.3648

>NTDB_id=44192 O3Y_RS02815 WP_000116737.1 564395..565402(+) (rpoS) [Vibrio cholerae IEC224]
MSVSNTVTKVEEFDFEDEALEVLETDAELTSDEELVAVEGASEDVREEFDASAKSLDATQMYLSEIGFSPLLTAEEEVLY
ARRALRGDEAARKRMIESNLRLVVKISRRYSNRGLALLDLIEEGNLGLIRAVEKFDPERGFRFSTYATWWIRQTIERALM
NQTRTIRLPIHVVKELNIYLRTARELSQRLDHEPTPEEIALELDRPVDDVTKMLRLNERISSVDTPIGGDGDKALLDILP
DSHNADPEFSTQDDDIRESLLNWLDELNPKQKEVLARRFGLLGYEPSTLEEVGREINLTRERVRQIQVEGLRRLREILVK
QGLNMEALFNVEYDN

Nucleotide


Download         Length: 1008 bp        

>NTDB_id=44192 O3Y_RS02815 WP_000116737.1 564395..565402(+) (rpoS) [Vibrio cholerae IEC224]
ATGAGTGTCAGCAATACCGTAACCAAAGTAGAAGAGTTCGATTTTGAAGATGAAGCACTGGAAGTGCTAGAAACTGATGC
CGAGCTCACCAGTGATGAAGAATTAGTTGCTGTTGAAGGGGCAAGTGAAGACGTTCGTGAAGAGTTTGATGCTTCTGCGA
AAAGTCTTGATGCGACCCAGATGTATCTCAGCGAAATTGGTTTTTCACCGCTCCTTACTGCCGAAGAAGAAGTGCTTTAT
GCTCGTCGTGCCTTACGTGGTGATGAAGCCGCACGTAAACGCATGATTGAAAGTAACTTGCGTCTGGTGGTAAAAATTTC
ACGCCGTTACAGCAACCGAGGATTAGCACTGCTCGATCTGATTGAAGAAGGTAATCTTGGTCTGATCCGTGCGGTTGAGA
AATTCGATCCAGAACGCGGTTTCCGCTTCTCTACCTACGCAACATGGTGGATCCGTCAAACCATTGAACGTGCGCTGATG
AACCAAACACGCACCATTCGTCTACCGATTCATGTCGTCAAAGAGCTGAACATTTATTTGCGTACTGCTCGCGAATTATC
ACAGCGCCTTGACCACGAACCTACACCAGAAGAAATTGCTCTTGAGTTAGACCGACCTGTCGATGATGTCACTAAGATGC
TGCGTCTTAACGAACGGATCAGCTCAGTGGATACGCCAATTGGTGGGGATGGAGATAAGGCACTGCTGGATATTTTGCCA
GACTCTCACAATGCCGATCCTGAGTTTTCAACTCAAGATGATGACATTCGTGAATCGCTGCTCAACTGGTTGGATGAACT
TAATCCAAAGCAAAAAGAAGTGCTTGCGCGTCGCTTTGGGCTTCTTGGCTATGAACCATCGACCTTGGAAGAAGTGGGTC
GTGAGATCAATCTCACTCGTGAGCGTGTTCGCCAAATCCAAGTGGAAGGTCTACGTCGTCTGCGTGAGATTTTGGTGAAA
CAAGGTTTGAATATGGAAGCGCTGTTTAACGTCGAATACGACAACTAA

Domains

Predicted by InterproScan.

Sigma-70, region 4 (Sigma70_r4)

(263-316)

Sigma-70 region 3 (Sigma70_r3)

(175-249)

Sigma-70 factor, region 1.2 (Sigma70_r1_2)

(57-90)

Sigma-70 region 2 (Sigma70_r2)

(95-164)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB O51804

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  rpoS Vibrio cholerae O1 biovar El Tor strain E7946

100

100

1

Multiple sequence alignment