Detailed information    

insolico Bioinformatically predicted

Overview


Name   comGF   Type   Machinery gene
Locus tag   IRJ24_RS14205 Genome accession   NZ_CP064093
Coordinates   2712949..2713332 (+) Length   127 a.a.
NCBI ID   WP_003230168.1    Uniprot ID   P25958
Organism   Bacillus subtilis strain N1282-4at     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 2707949..2718332
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  IRJ24_RS14175 corA 2708402..2709355 (+) 954 WP_004399136.1 magnesium transporter CorA -
  IRJ24_RS14180 comGA 2709767..2710837 (+) 1071 WP_004399124.1 competence protein ComGA Machinery gene
  IRJ24_RS14185 comGB 2710824..2711861 (+) 1038 WP_009967727.1 comG operon protein ComGB Machinery gene
  IRJ24_RS14190 comGC 2711875..2712171 (+) 297 WP_003230162.1 comG operon protein ComGC Machinery gene
  IRJ24_RS14195 comGD 2712161..2712592 (+) 432 WP_004398628.1 comG operon protein ComGD Machinery gene
  IRJ24_RS14200 comGE 2712576..2712923 (+) 348 WP_003230165.1 ComG operon protein 5 Machinery gene
  IRJ24_RS14205 comGF 2712949..2713332 (+) 384 WP_003230168.1 ComG operon protein ComGF Machinery gene
  IRJ24_RS14210 comGG 2713333..2713707 (+) 375 WP_003230170.1 ComG operon protein ComGG Machinery gene
  IRJ24_RS14215 spoIIT 2713778..2713957 (+) 180 WP_003230176.1 YqzE family protein -
  IRJ24_RS14220 yqzG 2713999..2714325 (-) 327 WP_003246051.1 YqzG/YhdC family protein -
  IRJ24_RS14225 tapA 2714597..2715358 (+) 762 WP_004399106.1 amyloid fiber anchoring/assembly protein TapA -
  IRJ24_RS14230 sipW 2715342..2715914 (+) 573 WP_003246088.1 signal peptidase I -
  IRJ24_RS14235 tasA 2715978..2716763 (+) 786 WP_004398632.1 biofilm matrix protein TasA -
  IRJ24_RS14240 sinR 2716856..2717191 (-) 336 WP_003226345.1 transcriptional regulator SinR Regulator
  IRJ24_RS14245 sinI 2717225..2717398 (-) 174 WP_003230187.1 anti-repressor SinI family protein Regulator

Sequence


Protein


Download         Length: 127 a.a.        Molecular weight: 14281.37 Da        Isoelectric Point: 5.8929

>NTDB_id=441760 IRJ24_RS14205 WP_003230168.1 2712949..2713332(+) (comGF) [Bacillus subtilis strain N1282-4at]
MLISGSLAAIIHLFLSRQQEHDGFTQQEWMISIEQMMNECKESQAVKTAEHGSVLICTNLSGQDIRFDIYHSMIRKRVDG
KGHVPILDHITAMKADIENGVVLLKIESEDQKVYQTAFPVYSYLGGG

Nucleotide


Download         Length: 384 bp        

>NTDB_id=441760 IRJ24_RS14205 WP_003230168.1 2712949..2713332(+) (comGF) [Bacillus subtilis strain N1282-4at]
TTGCTCATATCAGGATCGTTAGCTGCGATTATCCATCTGTTTTTGTCTCGACAGCAGGAACATGACGGTTTCACACAGCA
GGAATGGATGATTTCGATAGAACAGATGATGAATGAATGCAAGGAATCACAGGCAGTTAAGACAGCCGAGCATGGGAGCG
TGTTAATCTGCACCAATCTTTCCGGACAAGACATCCGTTTTGACATTTATCATTCAATGATAAGAAAAAGAGTGGATGGC
AAAGGGCATGTTCCGATTTTAGATCATATTACTGCCATGAAAGCTGATATTGAAAATGGTGTTGTTTTGCTGAAAATTGA
GAGTGAAGACCAAAAAGTGTATCAAACTGCTTTTCCAGTCTATTCGTATTTAGGAGGGGGGTGA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB P25958

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGF Bacillus subtilis subsp. subtilis str. 168

100

100

1