Detailed information
Overview
| Name | sinI | Type | Regulator |
| Locus tag | HC659_RS12120 | Genome accession | NZ_CP051465 |
| Coordinates | 2392876..2393049 (+) | Length | 57 a.a. |
| NCBI ID | WP_003230187.1 | Uniprot ID | A0A063X7W9 |
| Organism | Bacillus subtilis subsp. subtilis strain UCMB5121 | ||
| Function | inhibit the expression of sinR (predicted from homology) Competence regulation |
||
Genomic Context
Location: 2387876..2398049
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| HC659_RS12105 (HC659_23930) | gcvT | 2388675..2389763 (-) | 1089 | WP_004398598.1 | glycine cleavage system aminomethyltransferase GcvT | - |
| HC659_RS12110 (HC659_23940) | hepAA | 2390205..2391878 (+) | 1674 | WP_029726726.1 | SNF2-related protein | - |
| HC659_RS12115 (HC659_23950) | yqhG | 2391899..2392693 (+) | 795 | WP_015714249.1 | YqhG family protein | - |
| HC659_RS12120 (HC659_23960) | sinI | 2392876..2393049 (+) | 174 | WP_003230187.1 | anti-repressor SinI | Regulator |
| HC659_RS12125 (HC659_23970) | sinR | 2393083..2393418 (+) | 336 | WP_003226345.1 | transcriptional regulator SinR | Regulator |
| HC659_RS12130 (HC659_23980) | tasA | 2393511..2394296 (-) | 786 | WP_014664586.1 | biofilm matrix protein TasA | - |
| HC659_RS12135 (HC659_23990) | sipW | 2394360..2394932 (-) | 573 | WP_072692741.1 | signal peptidase I SipW | - |
| HC659_RS12140 (HC659_24000) | tapA | 2394916..2395677 (-) | 762 | WP_029726724.1 | amyloid fiber anchoring/assembly protein TapA | - |
| HC659_RS12145 (HC659_24010) | yqzG | 2395949..2396275 (+) | 327 | WP_003246051.1 | YqzG/YhdC family protein | - |
| HC659_RS12150 (HC659_24020) | spoIITA | 2396317..2396496 (-) | 180 | WP_029726723.1 | YqzE family protein | - |
| HC659_RS12155 (HC659_24030) | comGG | 2396568..2396942 (-) | 375 | WP_029726722.1 | ComG operon protein ComGG | Machinery gene |
| HC659_RS12160 (HC659_24040) | comGF | 2396943..2397326 (-) | 384 | WP_032722118.1 | ComG operon protein ComGF | Machinery gene |
| HC659_RS12165 (HC659_24050) | comGE | 2397352..2397699 (-) | 348 | WP_003230165.1 | ComG operon protein 5 | Machinery gene |
Sequence
Protein
Download Length: 57 a.a. Molecular weight: 6601.52 Da Isoelectric Point: 6.7231
>NTDB_id=438570 HC659_RS12120 WP_003230187.1 2392876..2393049(+) (sinI) [Bacillus subtilis subsp. subtilis strain UCMB5121]
MKNAKQEHFELDQEWVELMVEAKEANISPEEIRKYLLLNKKSAHPGPAARSHTVNPF
MKNAKQEHFELDQEWVELMVEAKEANISPEEIRKYLLLNKKSAHPGPAARSHTVNPF
Nucleotide
Download Length: 174 bp
>NTDB_id=438570 HC659_RS12120 WP_003230187.1 2392876..2393049(+) (sinI) [Bacillus subtilis subsp. subtilis strain UCMB5121]
ATGAAGAATGCAAAACAAGAGCACTTTGAATTGGATCAAGAATGGGTTGAATTAATGGTGGAAGCCAAAGAGGCAAATAT
CAGCCCGGAAGAAATACGAAAATATTTACTTTTAAACAAAAAGTCTGCTCATCCTGGTCCGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA
ATGAAGAATGCAAAACAAGAGCACTTTGAATTGGATCAAGAATGGGTTGAATTAATGGTGGAAGCCAAAGAGGCAAATAT
CAGCCCGGAAGAAATACGAAAATATTTACTTTTAAACAAAAAGTCTGCTCATCCTGGTCCGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| sinI | Bacillus subtilis subsp. subtilis str. 168 |
100 |
100 |
1 |