Detailed information    

insolico Bioinformatically predicted

Overview

Name   comGE   Type   Machinery gene
Locus tag   HC660_RS12285 Genome accession   NZ_CP051464
Coordinates   2354151..2354498 (-) Length   115 a.a.
NCBI ID   WP_168748233.1    Uniprot ID   -
Organism   Bacillus mojavensis strain UCMB5075     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context

Location: 2349151..2359498
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  HC660_RS12240 (HC660_23400) sinI 2349676..2349849 (+) 174 WP_010334916.1 anti-repressor SinI family protein Regulator
  HC660_RS12245 (HC660_23410) sinR 2349883..2350218 (+) 336 WP_003226345.1 transcriptional regulator SinR Regulator
  HC660_RS12250 (HC660_23420) tasA 2350306..2351091 (-) 786 WP_168748227.1 biofilm matrix protein TasA -
  HC660_RS12255 (HC660_23430) - 2351156..2351740 (-) 585 WP_168748228.1 signal peptidase I -
  HC660_RS12260 (HC660_23440) tapA 2351712..2352473 (-) 762 WP_168748229.1 amyloid fiber anchoring/assembly protein TapA -
  HC660_RS12265 (HC660_23450) - 2352750..2353073 (+) 324 WP_168748230.1 YqzG/YhdC family protein -
  HC660_RS12270 (HC660_23460) - 2353116..2353295 (-) 180 WP_003236949.1 YqzE family protein -
  HC660_RS12275 (HC660_23470) comGG 2353367..2353741 (-) 375 WP_168748231.1 competence type IV pilus minor pilin ComGG Machinery gene
  HC660_RS12280 (HC660_23480) comGF 2353742..2354125 (-) 384 WP_168748232.1 competence type IV pilus minor pilin ComGF Machinery gene
  HC660_RS12285 (HC660_23490) comGE 2354151..2354498 (-) 348 WP_168748233.1 competence type IV pilus minor pilin ComGE Machinery gene
  HC660_RS12290 (HC660_23500) comGD 2354482..2354913 (-) 432 WP_168748234.1 competence type IV pilus minor pilin ComGD Machinery gene
  HC660_RS12295 (HC660_23510) comGC 2354903..2355199 (-) 297 WP_168748235.1 competence type IV pilus major pilin ComGC Machinery gene
  HC660_RS12300 (HC660_23520) comGB 2355213..2356250 (-) 1038 WP_168748236.1 competence type IV pilus assembly protein ComGB Machinery gene
  HC660_RS12305 (HC660_23530) comGA 2356237..2357307 (-) 1071 WP_168748237.1 competence protein ComGA Machinery gene
  HC660_RS21095 (HC660_23540) - 2357659..2357829 (-) 171 WP_244956459.1 CBS domain-containing protein -
  HC660_RS12315 (HC660_23550) - 2358063..2359013 (-) 951 WP_010334929.1 magnesium transporter CorA family protein -

Sequence

Protein


Download         Length: 115 a.a.        Molecular weight: 13254.06 Da        Isoelectric Point: 4.3440

>NTDB_id=438490 HC660_RS12285 WP_168748233.1 2354151..2354498(-) (comGE) [Bacillus mojavensis strain UCMB5075]
MWRENKGFSTIETMSALSIWLFMLLTIVPMWDKLIADEHIADSREIGYQLVNESIGQYMLTGAGNSSKTVSMNNNKYSMT
WEEEGEYQNVCISSDAYKDKPFCLSILRTDWLYAS

Nucleotide


Download         Length: 348 bp        

>NTDB_id=438490 HC660_RS12285 WP_168748233.1 2354151..2354498(-) (comGE) [Bacillus mojavensis strain UCMB5075]
ATGTGGAGAGAAAATAAAGGCTTTTCTACAATTGAAACAATGTCTGCCCTTAGCATATGGCTGTTTATGCTTCTGACAAT
TGTGCCGATGTGGGATAAGCTGATAGCTGATGAACATATAGCGGACTCCAGAGAAATTGGTTATCAGCTTGTTAATGAAA
GCATAGGCCAATATATGCTGACAGGGGCAGGAAATTCATCAAAGACTGTTTCAATGAACAATAACAAATACTCGATGACA
TGGGAGGAGGAGGGAGAATATCAAAACGTATGTATCTCATCAGACGCCTATAAAGACAAGCCATTTTGCCTCAGCATTTT
GCGGACAGACTGGCTATACGCTTCTTAA

Domains


No domain identified.



Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGE Bacillus subtilis subsp. subtilis str. 168

71.304

100

0.713