Detailed information    

insolico Bioinformatically predicted

Overview

Name   comB7   Type   Machinery gene
Locus tag   HGK49_RS00195 Genome accession   NZ_CP051434
Coordinates   33348..33461 (+) Length   37 a.a.
NCBI ID   WP_001218100.1    Uniprot ID   -
Organism   Helicobacter pylori strain ASHA-004     
Function   transformation-associated type IV transport system (predicted from homology)   
DNA binding and uptake

Genomic Context

Location: 28348..38461
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  HGK49_RS00170 (HGK49_00170) - 28398..30620 (+) 2223 WP_202132914.1 ATP-dependent Clp protease ATP-binding subunit -
  HGK49_RS00175 (HGK49_00175) panD 30610..30960 (+) 351 WP_029647093.1 aspartate 1-decarboxylase -
  HGK49_RS00180 (HGK49_00180) - 30971..31264 (+) 294 WP_000347917.1 YbaB/EbfC family nucleoid-associated protein -
  HGK49_RS00185 (HGK49_00185) - 31264..32271 (+) 1008 WP_202133382.1 PDZ domain-containing protein -
  HGK49_RS00190 (HGK49_00190) comB6 32277..33332 (+) 1056 WP_202132915.1 P-type conjugative transfer protein TrbL Machinery gene
  HGK49_RS00195 (HGK49_00195) comB7 33348..33461 (+) 114 WP_001218100.1 hypothetical protein Machinery gene
  HGK49_RS00200 (HGK49_00200) comB8 33454..34200 (+) 747 WP_202132916.1 virB8 family protein Machinery gene
  HGK49_RS00205 (HGK49_00205) comB9 34200..35168 (+) 969 WP_202132917.1 TrbG/VirB9 family P-type conjugative transfer protein Machinery gene
  HGK49_RS00210 (HGK49_00210) comB10 35161..36297 (+) 1137 WP_202132918.1 DNA type IV secretion system protein ComB10 Machinery gene
  HGK49_RS00215 (HGK49_00215) - 36367..37779 (+) 1413 WP_202132919.1 mannose-1-phosphate guanylyltransferase/mannose-6-phosphate isomerase -

Sequence

Protein


Download         Length: 37 a.a.        Molecular weight: 4263.19 Da        Isoelectric Point: 9.3572

>NTDB_id=438263 HGK49_RS00195 WP_001218100.1 33348..33461(+) (comB7) [Helicobacter pylori strain ASHA-004]
MRIFSVIMGIMLFGCTSKVHEMKKSPCTLYENRLNLA

Nucleotide


Download         Length: 114 bp        

>NTDB_id=438263 HGK49_RS00195 WP_001218100.1 33348..33461(+) (comB7) [Helicobacter pylori strain ASHA-004]
ATGAGAATTTTTTCTGTCATTATGGGAATCATGTTGTTTGGTTGCACCAGTAAGGTGCATGAGATGAAAAAAAGCCCTTG
CACATTGTATGAAAACAGGTTGAATCTTGCATGA

Domains


No domain identified.



Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comB7 Helicobacter pylori P1

89.189

100

0.892