Detailed information    

insolico Bioinformatically predicted

Overview

Name   pilL   Type   Machinery gene
Locus tag   GHB95_RS02340 Genome accession   NZ_CP050930
Coordinates   450892..451365 (+) Length   157 a.a.
NCBI ID   WP_174813111.1    Uniprot ID   -
Organism   Neisseria gonorrhoeae strain NG211     
Function   type IV pilus (predicted from homology)   
DNA binding and uptake

Related MGE

Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
Prophage 451911..489410 450892..451365 flank 546


Gene organization within MGE regions


Location: 450892..489410
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  GHB95_RS02340 (GHB95_02340) pilL 450892..451365 (+) 474 WP_174813111.1 PilX family type IV pilin Machinery gene
  GHB95_RS02345 (GHB95_02345) - 451977..452422 (-) 446 Protein_458 AzlC family ABC transporter permease -
  GHB95_RS02350 (GHB95_02350) dut 452588..453040 (+) 453 WP_050303745.1 dUTP diphosphatase -
  GHB95_RS02355 (GHB95_02355) dapC 453118..454305 (+) 1188 WP_164823235.1 succinyldiaminopimelate transaminase -
  GHB95_RS02360 (GHB95_02360) yaaA 454616..455395 (+) 780 WP_003694987.1 peroxide stress protein YaaA -
  GHB95_RS02375 (GHB95_02375) - 455926..457122 (+) 1197 WP_017147117.1 integrase arm-type DNA-binding domain-containing protein -
  GHB95_RS02380 (GHB95_02380) - 457478..457747 (-) 270 WP_003687928.1 hypothetical protein -
  GHB95_RS02385 (GHB95_02385) - 457942..458625 (-) 684 WP_003687929.1 DUF2786 domain-containing protein -
  GHB95_RS12145 - 458939..459172 (-) 234 Protein_465 hypothetical protein -
  GHB95_RS02395 (GHB95_02395) - 459283..459498 (-) 216 WP_003691538.1 hypothetical protein -
  GHB95_RS02400 (GHB95_02400) - 459550..460041 (-) 492 WP_003691537.1 siphovirus Gp157 family protein -
  GHB95_RS02405 (GHB95_02405) - 460038..460220 (-) 183 WP_003691535.1 hypothetical protein -
  GHB95_RS02410 (GHB95_02410) - 460360..461046 (-) 687 WP_082278088.1 hypothetical protein -
  GHB95_RS02415 (GHB95_02415) - 461115..461276 (-) 162 WP_003693867.1 hypothetical protein -
  GHB95_RS02420 (GHB95_02420) - 461273..461548 (-) 276 WP_047918704.1 hypothetical protein -
  GHB95_RS02425 (GHB95_02425) - 461701..462033 (-) 333 WP_003695500.1 hypothetical protein -
  GHB95_RS02430 (GHB95_02430) - 462174..462461 (-) 288 WP_050157611.1 hypothetical protein -
  GHB95_RS02435 (GHB95_02435) - 462458..462934 (-) 477 WP_002255718.1 hypothetical protein -
  GHB95_RS02440 (GHB95_02440) - 462967..463167 (-) 201 WP_003692842.1 hypothetical protein -
  GHB95_RS02445 (GHB95_02445) - 463365..463778 (-) 414 WP_003687963.1 hypothetical protein -
  GHB95_RS02450 (GHB95_02450) - 463775..464236 (-) 462 WP_003687965.1 helix-turn-helix transcriptional regulator -
  GHB95_RS02455 (GHB95_02455) - 464253..464690 (-) 438 WP_003687967.1 hypothetical protein -
  GHB95_RS02460 (GHB95_02460) - 464803..465519 (-) 717 WP_003687969.1 LexA family transcriptional regulator -
  GHB95_RS02465 (GHB95_02465) - 465588..465824 (+) 237 WP_003687971.1 Cro/CI family transcriptional regulator -
  GHB95_RS02470 (GHB95_02470) - 465904..466059 (+) 156 WP_003689578.1 hypothetical protein -
  GHB95_RS02475 (GHB95_02475) - 466036..466224 (-) 189 WP_050157615.1 hypothetical protein -
  GHB95_RS02480 (GHB95_02480) - 466397..466624 (+) 228 WP_003691442.1 helix-turn-helix domain-containing protein -
  GHB95_RS02485 (GHB95_02485) - 466621..467631 (+) 1011 WP_164823237.1 helix-turn-helix domain-containing protein -
  GHB95_RS02490 (GHB95_02490) - 467645..468427 (+) 783 WP_033910919.1 ATP-binding protein -
  GHB95_RS02495 (GHB95_02495) - 468440..468703 (+) 264 WP_174813108.1 hypothetical protein -
  GHB95_RS02500 (GHB95_02500) - 468741..469235 (+) 495 WP_041421248.1 DUF3310 domain-containing protein -
  GHB95_RS02505 (GHB95_02505) - 469412..469561 (+) 150 WP_003692854.1 hypothetical protein -
  GHB95_RS02510 - 469590..469871 (+) 282 WP_003689109.1 hypothetical protein -
  GHB95_RS02515 (GHB95_02510) - 469862..470299 (+) 438 WP_047918627.1 RusA family crossover junction endodeoxyribonuclease -
  GHB95_RS02520 (GHB95_02515) - 470292..470597 (+) 306 WP_003687981.1 nuclease domain-containing protein -
  GHB95_RS02525 (GHB95_02520) - 470594..470977 (+) 384 WP_003687982.1 recombination protein NinB -
  GHB95_RS02530 (GHB95_02525) - 470968..471486 (+) 519 WP_003687984.1 HNH endonuclease -
  GHB95_RS02535 (GHB95_02530) - 471551..471973 (+) 423 WP_003704254.1 hypothetical protein -
  GHB95_RS02540 - 471973..472512 (+) 540 WP_003690920.1 hypothetical protein -
  GHB95_RS02545 (GHB95_02545) - 472493..473767 (+) 1275 WP_003701186.1 PBSX family phage terminase large subunit -
  GHB95_RS02550 (GHB95_02550) - 473752..476019 (+) 2268 WP_237082000.1 hypothetical protein -
  GHB95_RS02555 (GHB95_02555) - 476256..477452 (+) 1197 WP_003687992.1 hypothetical protein -
  GHB95_RS02560 (GHB95_02560) - 477449..484762 (+) 7314 WP_050157501.1 PLxRFG domain-containing protein -
  GHB95_RS02565 (GHB95_02570) - 485388..486680 (+) 1293 WP_003687995.1 DUF4043 family protein -
  GHB95_RS02570 (GHB95_02575) - 486735..487208 (+) 474 WP_003687996.1 hypothetical protein -
  GHB95_RS02575 (GHB95_02580) - 487214..487699 (+) 486 WP_003687997.1 hypothetical protein -
  GHB95_RS02580 (GHB95_02585) - 487696..488370 (+) 675 WP_003687998.1 hypothetical protein -
  GHB95_RS02585 (GHB95_02590) - 488373..488522 (+) 150 WP_003706419.1 hypothetical protein -
  GHB95_RS02590 (GHB95_02595) - 488559..489410 (-) 852 WP_003704240.1 Bro-N domain-containing protein -

Sequence

Protein


Download         Length: 157 a.a.        Molecular weight: 17536.40 Da        Isoelectric Point: 9.8238

>NTDB_id=435686 GHB95_RS02340 WP_174813111.1 450892..451365(+) (pilL) [Neisseria gonorrhoeae strain NG211]
MEQKGFTLIEMMIVVTILGIISVIAIPSYQSYIEKGYQSQLYTEMVGINNVLKQFILKNPQDNNQTIKSKLEIFVSGYKM
NPKIAKKYSVSVKFVDAEKPRVYRLVGVPNVGTGYTLSVWMNSVGDGYKCRDAASAKTYKEQLSGDGGCEALSNRKK

Nucleotide


Download         Length: 474 bp        

>NTDB_id=435686 GHB95_RS02340 WP_174813111.1 450892..451365(+) (pilL) [Neisseria gonorrhoeae strain NG211]
ATGGAACAAAAAGGGTTTACATTGATTGAGATGATGATAGTTGTCACGATACTCGGCATCATCAGCGTCATTGCCATACC
TTCTTATCAGAGTTATATTGAAAAAGGCTATCAGTCCCAGCTTTATACGGAGATGGTCGGTATCAACAATGTTCTCAAAC
AGTTTATTTTGAAAAATCCCCAGGACAATAATCAGACCATCAAGAGCAAACTGGAAATATTTGTCTCAGGCTATAAGATG
AATCCGAAAATTGCCAAAAAATATAGTGTTTCGGTAAAGTTTGTCGATGCGGAAAAACCAAGGGTATACAGGTTGGTCGG
TGTTCCGAACGTGGGGACGGGTTATACCTTGTCGGTATGGATGAACAGCGTGGGCGACGGATACAAATGCCGTGATGCCG
CTTCGGCAAAGACCTATAAAGAGCAGTTGTCCGGAGACGGTGGTTGTGAAGCCTTATCCAACCGTAAGAAATAG

Domains

Predicted by InterproScan.

Prokaryotic N-terminal methylation motif (N_methyl)

(3-25)

Minor type IV pilin, PilX (Pilin_PilX)

(31-157)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  pilL Neisseria gonorrhoeae MS11

89.172

100

0.892
  pilX Neisseria meningitidis 8013

85.35

100

0.854