Detailed information
Bioinformatically predicted
Overview
| Name | sinI | Type | Regulator |
| Locus tag | BACAU_RS11955 | Genome accession | NC_016784 |
| Coordinates | 2517521..2517694 (+) | Length | 57 a.a. |
| NCBI ID | WP_003153105.1 | Uniprot ID | A7Z6M7 |
| Organism | Bacillus velezensis CAU B946 | ||
| Function | inhibit the expression of sinR (predicted from homology) Competence regulation |
||
Genomic Context
Location: 2512521..2522694
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| BACAU_RS11940 (BACAU_2302) | gcvT | 2513338..2514438 (-) | 1101 | WP_014305405.1 | glycine cleavage system aminomethyltransferase GcvT | - |
| BACAU_RS11945 (BACAU_2303) | - | 2514861..2516531 (+) | 1671 | WP_041481884.1 | DEAD/DEAH box helicase | - |
| BACAU_RS11950 (BACAU_2304) | - | 2516549..2517343 (+) | 795 | WP_014305407.1 | YqhG family protein | - |
| BACAU_RS11955 (BACAU_2305) | sinI | 2517521..2517694 (+) | 174 | WP_003153105.1 | anti-repressor SinI | Regulator |
| BACAU_RS11960 (BACAU_2306) | sinR | 2517728..2518063 (+) | 336 | WP_003153104.1 | transcriptional regulator SinR | Regulator |
| BACAU_RS11965 (BACAU_2307) | tasA | 2518111..2518896 (-) | 786 | WP_003153102.1 | biofilm matrix protein TasA | - |
| BACAU_RS11970 (BACAU_2308) | sipW | 2518960..2519544 (-) | 585 | WP_014305408.1 | signal peptidase I SipW | - |
| BACAU_RS11975 (BACAU_2309) | tapA | 2519516..2520187 (-) | 672 | WP_014305409.1 | amyloid fiber anchoring/assembly protein TapA | - |
| BACAU_RS11980 (BACAU_2310) | - | 2520446..2520775 (+) | 330 | WP_003153097.1 | DUF3889 domain-containing protein | - |
| BACAU_RS11985 (BACAU_2311) | - | 2520815..2520994 (-) | 180 | WP_003153093.1 | YqzE family protein | - |
| BACAU_RS11990 (BACAU_2312) | comGG | 2521051..2521428 (-) | 378 | WP_014305410.1 | competence type IV pilus minor pilin ComGG | Machinery gene |
| BACAU_RS11995 (BACAU_2313) | comGF | 2521429..2521824 (-) | 396 | WP_046559876.1 | competence type IV pilus minor pilin ComGF | - |
| BACAU_RS12000 (BACAU_2314) | comGE | 2521838..2522152 (-) | 315 | WP_041481885.1 | competence type IV pilus minor pilin ComGE | Machinery gene |
| BACAU_RS12005 (BACAU_2315) | comGD | 2522136..2522573 (-) | 438 | WP_014305413.1 | competence type IV pilus minor pilin ComGD | Machinery gene |
Sequence
Protein
Download Length: 57 a.a. Molecular weight: 6695.72 Da Isoelectric Point: 9.8170
>NTDB_id=43412 BACAU_RS11955 WP_003153105.1 2517521..2517694(+) (sinI) [Bacillus velezensis CAU B946]
MKNAKMEFSQLDKEWVELILEAQKANISLEEIRKYLLSHKKSSQHIQAARSHTVNPF
MKNAKMEFSQLDKEWVELILEAQKANISLEEIRKYLLSHKKSSQHIQAARSHTVNPF
Nucleotide
Download Length: 174 bp
>NTDB_id=43412 BACAU_RS11955 WP_003153105.1 2517521..2517694(+) (sinI) [Bacillus velezensis CAU B946]
ATGAAAAATGCAAAAATGGAATTTTCGCAATTAGATAAGGAATGGGTTGAGCTGATATTAGAAGCCCAAAAAGCAAATAT
CAGCCTAGAAGAAATACGCAAATACCTGCTTTCGCATAAAAAGTCTTCTCAACATATCCAGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA
ATGAAAAATGCAAAAATGGAATTTTCGCAATTAGATAAGGAATGGGTTGAGCTGATATTAGAAGCCCAAAAAGCAAATAT
CAGCCTAGAAGAAATACGCAAATACCTGCTTTCGCATAAAAAGTCTTCTCAACATATCCAGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| sinI | Bacillus subtilis subsp. subtilis str. 168 |
70.175 |
100 |
0.702 |