Detailed information    

insolico Bioinformatically predicted

Overview

Name   phrC   Type   Regulator
Locus tag   HCU65_RS02125 Genome accession   NZ_CP050705
Coordinates   432973..433092 (+) Length   39 a.a.
NCBI ID   WP_004430266.1    Uniprot ID   -
Organism   Bacillus atrophaeus strain PENSV20     
Function   antagonize RapC (predicted from homology)   
Competence regulation

Genomic Context

Location: 427973..438092
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  HCU65_RS02100 (HCU65_02100) - 428141..428890 (+) 750 WP_061669565.1 amino acid ABC transporter ATP-binding protein -
  HCU65_RS02105 (HCU65_02105) - 428906..430057 (+) 1152 WP_219947053.1 M20 peptidase aminoacylase family protein -
  HCU65_RS02110 (HCU65_02110) - 430054..431397 (+) 1344 WP_219947054.1 MmgE/PrpD family protein -
  HCU65_RS02115 (HCU65_02115) - 431438..431647 (+) 210 Protein_387 ATP-binding protein -
  HCU65_RS02120 (HCU65_02120) rapC 431841..432989 (+) 1149 WP_061669569.1 Rap family tetratricopeptide repeat protein Regulator
  HCU65_RS02125 (HCU65_02125) phrC 432973..433092 (+) 120 WP_004430266.1 PhrC/PhrF family phosphatase-inhibitory pheromone Regulator
  HCU65_RS02130 (HCU65_02130) - 433227..433334 (-) 108 WP_072053240.1 YjcZ family sporulation protein -
  HCU65_RS02135 (HCU65_02135) - 433538..433621 (-) 84 WP_371176570.1 YjcZ family sporulation protein -
  HCU65_RS02140 (HCU65_02140) - 433752..435116 (-) 1365 WP_219947055.1 aspartate kinase -
  HCU65_RS02145 (HCU65_02145) ceuB 435549..436499 (+) 951 WP_010789705.1 ABC transporter permease Machinery gene
  HCU65_RS02150 (HCU65_02150) - 436492..437439 (+) 948 WP_010789704.1 iron chelate uptake ABC transporter family permease subunit -

Sequence

Protein


Download         Length: 39 a.a.        Molecular weight: 4111.89 Da        Isoelectric Point: 7.9858

>NTDB_id=434094 HCU65_RS02125 WP_004430266.1 432973..433092(+) (phrC) [Bacillus atrophaeus strain PENSV20]
MKLKSKLLIICLAAAAVFATVGVSNAEAPDYQVTERGMT

Nucleotide


Download         Length: 120 bp        

>NTDB_id=434094 HCU65_RS02125 WP_004430266.1 432973..433092(+) (phrC) [Bacillus atrophaeus strain PENSV20]
ATGAAATTGAAATCTAAATTGCTCATTATTTGTTTGGCTGCAGCTGCTGTGTTTGCAACAGTTGGAGTGTCCAATGCTGA
AGCGCCTGATTATCAGGTGACAGAAAGAGGAATGACGTAA

Domains

Predicted by InterproScan.

Rap-phr extracellular signalling (PhrC_PhrF)

(3-39)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  phrC Bacillus subtilis subsp. subtilis str. 168

75

100

0.769