Detailed information    

insolico Bioinformatically predicted

Overview

Name   degQ   Type   Regulator
Locus tag   HCC49_RS14485 Genome accession   NZ_CP050462
Coordinates   2947569..2947709 (-) Length   46 a.a.
NCBI ID   WP_003152043.1    Uniprot ID   A3KLB4
Organism   Bacillus velezensis strain Htq6     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context

Location: 2942569..2952709
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  HCC49_RS14460 (HCC49_14460) - 2942915..2943298 (-) 384 WP_003152054.1 hotdog fold thioesterase -
  HCC49_RS14465 (HCC49_14465) comA 2943320..2943964 (-) 645 WP_003152052.1 response regulator transcription factor Regulator
  HCC49_RS14470 (HCC49_14470) comP 2944045..2946345 (-) 2301 WP_167860384.1 histidine kinase Regulator
  HCC49_RS14475 (HCC49_14475) comX 2946359..2946532 (-) 174 WP_102422026.1 competence pheromone ComX -
  HCC49_RS14480 (HCC49_14480) - 2946501..2947361 (-) 861 WP_167860385.1 polyprenyl synthetase family protein -
  HCC49_RS14485 (HCC49_14485) degQ 2947569..2947709 (-) 141 WP_003152043.1 degradation enzyme regulation protein DegQ Regulator
  HCC49_RS14490 (HCC49_14490) - 2948174..2948515 (+) 342 WP_014305721.1 hypothetical protein -
  HCC49_RS14495 (HCC49_14495) - 2948522..2949742 (-) 1221 WP_070082287.1 EAL and HDOD domain-containing protein -
  HCC49_RS14500 (HCC49_14500) - 2949872..2951338 (-) 1467 WP_014305722.1 nicotinate phosphoribosyltransferase -
  HCC49_RS14505 (HCC49_14505) - 2951356..2951907 (-) 552 WP_025853916.1 isochorismatase family cysteine hydrolase -
  HCC49_RS14510 (HCC49_14510) - 2952004..2952402 (-) 399 WP_003152031.1 DUF1694 domain-containing protein -

Sequence

Protein


Download         Length: 46 a.a.        Molecular weight: 5518.30 Da        Isoelectric Point: 4.9432

>NTDB_id=432977 HCC49_RS14485 WP_003152043.1 2947569..2947709(-) (degQ) [Bacillus velezensis strain Htq6]
MENKLEEVKQLLFRLENDIRETTDSLRNINKSIDQLDKFSYAMKIS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=432977 HCC49_RS14485 WP_003152043.1 2947569..2947709(-) (degQ) [Bacillus velezensis strain Htq6]
GTGGAAAACAAATTAGAAGAAGTAAAGCAATTATTATTCCGACTTGAAAATGATATCAGAGAAACAACCGACTCATTACG
AAACATTAACAAAAGCATTGATCAGCTCGATAAATTCTCATATGCAATGAAAATTTCTTAA

Domains

Predicted by InterproScan.

DegQ (SacQ) family (DegQ)

(1-46)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB A3KLB4

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

89.13

100

0.891