Detailed information    

insolico Bioinformatically predicted

Overview

Name   sinI   Type   Regulator
Locus tag   HCC49_RS11395 Genome accession   NZ_CP050462
Coordinates   2363978..2364151 (+) Length   57 a.a.
NCBI ID   WP_003153105.1    Uniprot ID   A7Z6M7
Organism   Bacillus velezensis strain Htq6     
Function   inhibit the expression of sinR (predicted from homology)   
Competence regulation

Genomic Context

Location: 2358978..2369151
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  HCC49_RS11380 (HCC49_11380) gcvT 2359791..2360891 (-) 1101 WP_058906182.1 glycine cleavage system aminomethyltransferase GcvT -
  HCC49_RS11385 (HCC49_11385) - 2361315..2362985 (+) 1671 WP_167860279.1 SNF2-related protein -
  HCC49_RS11390 (HCC49_11390) - 2363007..2363801 (+) 795 WP_014418368.1 YqhG family protein -
  HCC49_RS11395 (HCC49_11395) sinI 2363978..2364151 (+) 174 WP_003153105.1 anti-repressor SinI family protein Regulator
  HCC49_RS11400 (HCC49_11400) sinR 2364185..2364520 (+) 336 WP_003153104.1 transcriptional regulator SinR Regulator
  HCC49_RS11405 (HCC49_11405) - 2364568..2365353 (-) 786 WP_007408329.1 TasA family protein -
  HCC49_RS11410 (HCC49_11410) - 2365417..2366001 (-) 585 WP_012117977.1 signal peptidase I -
  HCC49_RS11415 (HCC49_11415) tapA 2365973..2366644 (-) 672 WP_167860280.1 amyloid fiber anchoring/assembly protein TapA -
  HCC49_RS11420 (HCC49_11420) - 2366903..2367232 (+) 330 WP_003153097.1 DUF3889 domain-containing protein -
  HCC49_RS11425 (HCC49_11425) - 2367272..2367451 (-) 180 WP_003153093.1 YqzE family protein -
  HCC49_RS11430 (HCC49_11430) comGG 2367508..2367885 (-) 378 WP_094247734.1 competence type IV pilus minor pilin ComGG Machinery gene
  HCC49_RS11435 (HCC49_11435) comGF 2367886..2368281 (-) 396 WP_094247733.1 competence type IV pilus minor pilin ComGF -
  HCC49_RS11440 (HCC49_11440) comGE 2368295..2368609 (-) 315 WP_015388003.1 competence type IV pilus minor pilin ComGE Machinery gene
  HCC49_RS11445 (HCC49_11445) comGD 2368593..2369030 (-) 438 WP_025852922.1 competence type IV pilus minor pilin ComGD Machinery gene

Sequence

Protein


Download         Length: 57 a.a.        Molecular weight: 6695.72 Da        Isoelectric Point: 9.8170

>NTDB_id=432955 HCC49_RS11395 WP_003153105.1 2363978..2364151(+) (sinI) [Bacillus velezensis strain Htq6]
MKNAKMEFSQLDKEWVELILEAQKANISLEEIRKYLLSHKKSSQHIQAARSHTVNPF

Nucleotide


Download         Length: 174 bp        

>NTDB_id=432955 HCC49_RS11395 WP_003153105.1 2363978..2364151(+) (sinI) [Bacillus velezensis strain Htq6]
ATGAAAAATGCAAAAATGGAATTTTCGCAATTAGATAAGGAATGGGTTGAGCTGATATTAGAAGCCCAAAAAGCAAATAT
CAGCCTAGAAGAAATACGCAAATACCTGCTTTCGCATAAAAAGTCTTCTCAACATATCCAGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA

Domains

Predicted by InterproScan.

Anti-repressor SinI (SinI)

(11-37)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB A7Z6M7

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sinI Bacillus subtilis subsp. subtilis str. 168

70.175

100

0.702