Detailed information    

insolico Bioinformatically predicted

Overview

Name   comGE   Type   Machinery gene
Locus tag   HCC49_RS11440 Genome accession   NZ_CP050462
Coordinates   2368295..2368609 (-) Length   104 a.a.
NCBI ID   WP_015388003.1    Uniprot ID   -
Organism   Bacillus velezensis strain Htq6     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context

Location: 2363295..2373609
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  HCC49_RS11395 (HCC49_11395) sinI 2363978..2364151 (+) 174 WP_003153105.1 anti-repressor SinI family protein Regulator
  HCC49_RS11400 (HCC49_11400) sinR 2364185..2364520 (+) 336 WP_003153104.1 transcriptional regulator SinR Regulator
  HCC49_RS11405 (HCC49_11405) - 2364568..2365353 (-) 786 WP_007408329.1 TasA family protein -
  HCC49_RS11410 (HCC49_11410) - 2365417..2366001 (-) 585 WP_012117977.1 signal peptidase I -
  HCC49_RS11415 (HCC49_11415) tapA 2365973..2366644 (-) 672 WP_167860280.1 amyloid fiber anchoring/assembly protein TapA -
  HCC49_RS11420 (HCC49_11420) - 2366903..2367232 (+) 330 WP_003153097.1 DUF3889 domain-containing protein -
  HCC49_RS11425 (HCC49_11425) - 2367272..2367451 (-) 180 WP_003153093.1 YqzE family protein -
  HCC49_RS11430 (HCC49_11430) comGG 2367508..2367885 (-) 378 WP_094247734.1 competence type IV pilus minor pilin ComGG Machinery gene
  HCC49_RS11435 (HCC49_11435) comGF 2367886..2368281 (-) 396 WP_094247733.1 competence type IV pilus minor pilin ComGF -
  HCC49_RS11440 (HCC49_11440) comGE 2368295..2368609 (-) 315 WP_015388003.1 competence type IV pilus minor pilin ComGE Machinery gene
  HCC49_RS11445 (HCC49_11445) comGD 2368593..2369030 (-) 438 WP_025852922.1 competence type IV pilus minor pilin ComGD Machinery gene
  HCC49_RS11450 (HCC49_11450) comGC 2369020..2369328 (-) 309 WP_003153087.1 competence type IV pilus major pilin ComGC Machinery gene
  HCC49_RS11455 (HCC49_11455) comGB 2369333..2370370 (-) 1038 WP_063174751.1 competence type IV pilus assembly protein ComGB Machinery gene
  HCC49_RS11460 (HCC49_11460) comGA 2370357..2371427 (-) 1071 WP_070082113.1 competence type IV pilus ATPase ComGA Machinery gene
  HCC49_RS11465 (HCC49_11465) - 2371619..2372569 (-) 951 WP_003153082.1 magnesium transporter CorA family protein -

Sequence

Protein


Download         Length: 104 a.a.        Molecular weight: 11844.85 Da        Isoelectric Point: 6.9470

>NTDB_id=432958 HCC49_RS11440 WP_015388003.1 2368295..2368609(-) (comGE) [Bacillus velezensis strain Htq6]
MLNGNKGFSTIETLSAMAIWLFLMTSIIPVWTGMLTDGLKIEDRQEAYQLLQKHISTYMMTGKKPPSPGVKWKEDGEYYK
VCAADRGEKEMCLSILKTDWLYAS

Nucleotide


Download         Length: 315 bp        

>NTDB_id=432958 HCC49_RS11440 WP_015388003.1 2368295..2368609(-) (comGE) [Bacillus velezensis strain Htq6]
ATGCTAAACGGAAATAAAGGGTTCTCTACTATTGAAACACTATCAGCAATGGCCATTTGGCTGTTCCTTATGACGTCTAT
CATTCCGGTCTGGACGGGCATGCTGACAGATGGTCTGAAAATAGAAGATCGCCAGGAAGCGTACCAGCTTCTTCAGAAAC
ATATCAGCACTTATATGATGACCGGGAAAAAGCCGCCGTCTCCCGGTGTGAAGTGGAAGGAGGATGGTGAGTATTACAAA
GTGTGTGCGGCTGACCGCGGCGAAAAAGAAATGTGCCTCAGCATTCTCAAAACAGACTGGCTTTACGCTTCTTAA

Domains


No domain identified.



Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGE Bacillus subtilis subsp. subtilis str. 168

43.478

100

0.481