Detailed information    

insolico Bioinformatically predicted

Overview

Name   sinI   Type   Regulator
Locus tag   HB674_RS11615 Genome accession   NZ_CP050448
Coordinates   2435913..2436086 (+) Length   57 a.a.
NCBI ID   WP_032874029.1    Uniprot ID   -
Organism   Bacillus velezensis strain BIM B-1312D     
Function   inhibit the expression of sinR (predicted from homology)   
Competence regulation

Genomic Context

Location: 2430913..2441086
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  HB674_RS11600 (HB674_11600) gcvT 2431727..2432827 (-) 1101 WP_032874033.1 glycine cleavage system aminomethyltransferase GcvT -
  HB674_RS11605 (HB674_11605) - 2433250..2434920 (+) 1671 WP_032874031.1 SNF2-related protein -
  HB674_RS11610 (HB674_11610) - 2434942..2435736 (+) 795 WP_007612541.1 YqhG family protein -
  HB674_RS11615 (HB674_11615) sinI 2435913..2436086 (+) 174 WP_032874029.1 anti-repressor SinI family protein Regulator
  HB674_RS11620 (HB674_11620) sinR 2436120..2436455 (+) 336 WP_003153104.1 transcriptional regulator SinR Regulator
  HB674_RS11625 (HB674_11625) - 2436503..2437288 (-) 786 WP_032874027.1 TasA family protein -
  HB674_RS11630 (HB674_11630) - 2437353..2437937 (-) 585 WP_032874025.1 signal peptidase I -
  HB674_RS11635 (HB674_11635) tapA 2437909..2438580 (-) 672 WP_032874023.1 amyloid fiber anchoring/assembly protein TapA -
  HB674_RS11640 (HB674_11640) - 2438839..2439168 (+) 330 WP_032874021.1 DUF3889 domain-containing protein -
  HB674_RS11645 (HB674_11645) - 2439209..2439388 (-) 180 WP_022552966.1 YqzE family protein -
  HB674_RS11650 (HB674_11650) comGG 2439445..2439822 (-) 378 WP_032874019.1 competence type IV pilus minor pilin ComGG Machinery gene
  HB674_RS11655 (HB674_11655) comGF 2439823..2440287 (-) 465 WP_223813077.1 competence type IV pilus minor pilin ComGF -
  HB674_RS11660 (HB674_11660) comGE 2440232..2440546 (-) 315 WP_032874016.1 competence type IV pilus minor pilin ComGE Machinery gene
  HB674_RS11665 (HB674_11665) comGD 2440530..2440967 (-) 438 WP_007612572.1 competence type IV pilus minor pilin ComGD Machinery gene

Sequence

Protein


Download         Length: 57 a.a.        Molecular weight: 6658.66 Da        Isoelectric Point: 9.8168

>NTDB_id=432782 HB674_RS11615 WP_032874029.1 2435913..2436086(+) (sinI) [Bacillus velezensis strain BIM B-1312D]
MKNAKMEFSQLDKEWVELILEAQKANISLEEIRKYLLSNKKSSQHVQAARSHTVNPF

Nucleotide


Download         Length: 174 bp        

>NTDB_id=432782 HB674_RS11615 WP_032874029.1 2435913..2436086(+) (sinI) [Bacillus velezensis strain BIM B-1312D]
ATGAAAAATGCAAAAATGGAATTTTCGCAATTAGATAAGGAATGGGTTGAGCTGATATTAGAAGCCCAAAAAGCAAATAT
CAGCCTAGAAGAAATACGCAAATACCTGCTTTCGAATAAAAAGTCTTCTCAACATGTCCAGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA

Domains

Predicted by InterproScan.

Anti-repressor SinI (SinI)

(11-37)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sinI Bacillus subtilis subsp. subtilis str. 168

71.93

100

0.719