Detailed information    

insolico Bioinformatically predicted

Overview

Name   comGE   Type   Machinery gene
Locus tag   HB674_RS11660 Genome accession   NZ_CP050448
Coordinates   2440232..2440546 (-) Length   104 a.a.
NCBI ID   WP_032874016.1    Uniprot ID   -
Organism   Bacillus velezensis strain BIM B-1312D     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context

Location: 2435232..2445546
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  HB674_RS11615 (HB674_11615) sinI 2435913..2436086 (+) 174 WP_032874029.1 anti-repressor SinI family protein Regulator
  HB674_RS11620 (HB674_11620) sinR 2436120..2436455 (+) 336 WP_003153104.1 transcriptional regulator SinR Regulator
  HB674_RS11625 (HB674_11625) - 2436503..2437288 (-) 786 WP_032874027.1 TasA family protein -
  HB674_RS11630 (HB674_11630) - 2437353..2437937 (-) 585 WP_032874025.1 signal peptidase I -
  HB674_RS11635 (HB674_11635) tapA 2437909..2438580 (-) 672 WP_032874023.1 amyloid fiber anchoring/assembly protein TapA -
  HB674_RS11640 (HB674_11640) - 2438839..2439168 (+) 330 WP_032874021.1 DUF3889 domain-containing protein -
  HB674_RS11645 (HB674_11645) - 2439209..2439388 (-) 180 WP_022552966.1 YqzE family protein -
  HB674_RS11650 (HB674_11650) comGG 2439445..2439822 (-) 378 WP_032874019.1 competence type IV pilus minor pilin ComGG Machinery gene
  HB674_RS11655 (HB674_11655) comGF 2439823..2440287 (-) 465 WP_223813077.1 competence type IV pilus minor pilin ComGF -
  HB674_RS11660 (HB674_11660) comGE 2440232..2440546 (-) 315 WP_032874016.1 competence type IV pilus minor pilin ComGE Machinery gene
  HB674_RS11665 (HB674_11665) comGD 2440530..2440967 (-) 438 WP_007612572.1 competence type IV pilus minor pilin ComGD Machinery gene
  HB674_RS11670 (HB674_11670) comGC 2440957..2441223 (-) 267 WP_042635730.1 competence type IV pilus major pilin ComGC Machinery gene
  HB674_RS11675 (HB674_11675) comGB 2441270..2442307 (-) 1038 WP_032874014.1 competence type IV pilus assembly protein ComGB Machinery gene
  HB674_RS11680 (HB674_11680) comGA 2442294..2443364 (-) 1071 WP_003153083.1 competence type IV pilus ATPase ComGA Machinery gene
  HB674_RS11685 (HB674_11685) - 2443561..2444511 (-) 951 WP_032874012.1 magnesium transporter CorA family protein -

Sequence

Protein


Download         Length: 104 a.a.        Molecular weight: 11902.88 Da        Isoelectric Point: 5.8321

>NTDB_id=432785 HB674_RS11660 WP_032874016.1 2440232..2440546(-) (comGE) [Bacillus velezensis strain BIM B-1312D]
MLNGNKGFSTIETLSAMAIWLFLMTSIIPVWTDMLTDGLKIEDRQEAYQLLQKHISTYMMTGKKPPSPGVKWKEDGEYYK
VCAADRGEKEMCLSILKTDWLYAS

Nucleotide


Download         Length: 315 bp        

>NTDB_id=432785 HB674_RS11660 WP_032874016.1 2440232..2440546(-) (comGE) [Bacillus velezensis strain BIM B-1312D]
ATGCTAAACGGAAATAAGGGGTTCTCTACTATTGAAACACTATCAGCAATGGCCATTTGGCTGTTCCTTATGACGTCTAT
CATTCCGGTCTGGACGGACATGCTGACAGATGGTCTGAAAATAGAAGATCGCCAGGAAGCGTACCAGCTTCTTCAGAAAC
ATATCAGCACTTATATGATGACCGGAAAAAAGCCGCCGTCTCCCGGTGTGAAGTGGAAGGAGGATGGTGAGTATTACAAA
GTGTGTGCGGCTGACCGCGGTGAAAAAGAAATGTGCCTCAGTATTCTCAAAACAGACTGGCTTTACGCTTCTTAA

Domains


No domain identified.



Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGE Bacillus subtilis subsp. subtilis str. 168

43.478

100

0.481