Detailed information    

insolico Bioinformatically predicted

Overview


Name   comC/blpC   Type   Regulator
Locus tag   HB753_RS00465 Genome accession   NZ_CP050270
Coordinates   96007..96147 (-) Length   46 a.a.
NCBI ID   WP_002270250.1    Uniprot ID   Q9APK7
Organism   Streptococcus mutans strain S4     
Function   binding to ComD; induce autophosphorylation of ComD; regulation of comX expression (predicted from homology)   
Competence regulation

Genomic Context


Location: 91007..101147
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  HB753_RS00445 (HB753_00445) - 92007..92633 (+) 627 WP_002273094.1 hypothetical protein -
  HB753_RS00450 (HB753_00450) - 92681..93319 (+) 639 WP_002271525.1 VTT domain-containing protein -
  HB753_RS00455 (HB753_00455) comE/blpR 93790..94542 (+) 753 WP_002298154.1 response regulator transcription factor Regulator
  HB753_RS00460 (HB753_00460) - 94539..95865 (+) 1327 Protein_88 sensor histidine kinase -
  HB753_RS00465 (HB753_00465) comC/blpC 96007..96147 (-) 141 WP_002270250.1 ComC/BlpC family leader-containing pheromone/bacteriocin Regulator
  HB753_RS00470 (HB753_00470) cipB 96415..96645 (+) 231 WP_002309764.1 Blp family class II bacteriocin Regulator
  HB753_RS00475 (HB753_00475) - 96776..97177 (+) 402 WP_002310604.1 hypothetical protein -
  HB753_RS00480 (HB753_00480) - 98557..98976 (+) 420 WP_019804903.1 hypothetical protein -
  HB753_RS00485 (HB753_00485) - 99123..99527 (+) 405 WP_002263912.1 hypothetical protein -
  HB753_RS10325 - 99650..99862 (-) 213 Protein_94 IS3 family transposase -
  HB753_RS00490 (HB753_00490) - 100302..100466 (+) 165 WP_002265308.1 hypothetical protein -
  HB753_RS00495 (HB753_00495) - 100871..101083 (+) 213 WP_002309424.1 Blp family class II bacteriocin -

Sequence


Protein


Download         Length: 46 a.a.        Molecular weight: 5195.02 Da        Isoelectric Point: 10.4929

>NTDB_id=431030 HB753_RS00465 WP_002270250.1 96007..96147(-) (comC/blpC) [Streptococcus mutans strain S4]
MKKTPSLKNDFKEIKTDELEIIIGGSGSLSTFFRLFNRSFTQALGK

Nucleotide


Download         Length: 141 bp        

>NTDB_id=431030 HB753_RS00465 WP_002270250.1 96007..96147(-) (comC/blpC) [Streptococcus mutans strain S4]
ATGAAAAAAACACCATCATTAAAAAATGACTTTAAAGAAATTAAGACTGATGAATTAGAGATTATCATTGGCGGAAGTGG
AAGCCTGTCAACATTTTTCCGGCTGTTTAACAGAAGTTTTACACAAGCTTTGGGAAAATAA

Domains


Predicted by InterproScan.

(1-32)


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB Q9APK7

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comC/blpC Streptococcus mutans UA159

97.826

100

0.978