Detailed information    

insolico Bioinformatically predicted

Overview


Name   ssb   Type   Machinery gene
Locus tag   G9U56_RS06550 Genome accession   NZ_CP049940
Coordinates   1287368..1287895 (-) Length   175 a.a.
NCBI ID   WP_277375511.1    Uniprot ID   -
Organism   Weissella paramesenteroides strain W31     
Function   ssDNA binding (predicted from homology)   
DNA processing

Related MGE


Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
Prophage 1257388..1301513 1287368..1287895 within 0


Gene organization within MGE regions


Location: 1257388..1301513
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  G9U56_RS06365 - 1257388..1258491 (-) 1104 WP_277375482.1 GH25 family lysozyme -
  G9U56_RS06370 (G9U56_06320) - 1258502..1258786 (-) 285 WP_277375483.1 phage holin -
  G9U56_RS06375 (G9U56_06325) - 1258803..1259036 (-) 234 WP_277375484.1 hypothetical protein -
  G9U56_RS06380 (G9U56_06330) - 1259049..1259318 (-) 270 WP_277375485.1 hypothetical protein -
  G9U56_RS06385 (G9U56_06335) - 1259321..1259716 (-) 396 WP_277375486.1 hypothetical protein -
  G9U56_RS06390 (G9U56_06340) - 1259731..1264533 (-) 4803 WP_277375487.1 phage tail spike protein -
  G9U56_RS06395 (G9U56_06345) - 1264530..1265336 (-) 807 WP_277375488.1 distal tail protein Dit -
  G9U56_RS06400 (G9U56_06350) - 1265355..1268852 (-) 3498 WP_277375489.1 phage tail tape measure protein -
  G9U56_RS06405 (G9U56_06355) - 1268853..1269185 (-) 333 WP_284566574.1 hypothetical protein -
  G9U56_RS06410 (G9U56_06360) - 1269278..1269616 (-) 339 WP_277375491.1 tail assembly chaperone -
  G9U56_RS06415 (G9U56_06365) - 1269740..1270303 (-) 564 WP_277375492.1 phage major tail protein, TP901-1 family -
  G9U56_RS06420 (G9U56_06370) - 1270319..1270714 (-) 396 WP_277375493.1 hypothetical protein -
  G9U56_RS06425 (G9U56_06375) - 1270711..1271085 (-) 375 WP_277375494.1 HK97-gp10 family putative phage morphogenesis protein -
  G9U56_RS06430 (G9U56_06380) - 1271075..1271389 (-) 315 WP_277375495.1 hypothetical protein -
  G9U56_RS06435 (G9U56_06385) - 1271399..1271743 (-) 345 WP_277375496.1 phage head-tail connector protein -
  G9U56_RS06440 (G9U56_06390) - 1271761..1272042 (-) 282 WP_277375497.1 phosphoenolpyruvate synthase -
  G9U56_RS06445 (G9U56_06395) - 1272108..1272935 (-) 828 WP_002828438.1 N4-gp56 family major capsid protein -
  G9U56_RS06450 (G9U56_06400) - 1272939..1273535 (-) 597 WP_277375498.1 DUF4355 domain-containing protein -
  G9U56_RS06455 (G9U56_06405) - 1273703..1274668 (-) 966 WP_277375499.1 minor capsid protein -
  G9U56_RS06460 (G9U56_06410) - 1274658..1276151 (-) 1494 WP_277375500.1 phage portal protein -
  G9U56_RS06465 (G9U56_06415) - 1276162..1277451 (-) 1290 WP_277375501.1 PBSX family phage terminase large subunit -
  G9U56_RS06470 (G9U56_06420) - 1277444..1277950 (-) 507 WP_277375502.1 terminase small subunit -
  G9U56_RS06475 (G9U56_06425) - 1278221..1278793 (-) 573 WP_275016523.1 hypothetical protein -
  G9U56_RS06480 (G9U56_06430) - 1279370..1279576 (-) 207 WP_002828449.1 CsbD family protein -
  G9U56_RS06485 (G9U56_06435) - 1279675..1279926 (-) 252 WP_040760815.1 GlsB/YeaQ/YmgE family stress response membrane protein -
  G9U56_RS06495 (G9U56_06445) - 1280290..1280730 (-) 441 WP_277375503.1 DUF722 domain-containing protein -
  G9U56_RS06500 (G9U56_06450) - 1280914..1282572 (+) 1659 WP_277375504.1 hypothetical protein -
  G9U56_RS06505 (G9U56_06455) - 1282732..1283187 (-) 456 WP_277375505.1 GAF domain-containing protein -
  G9U56_RS06510 (G9U56_06460) pnuC 1283255..1283950 (-) 696 WP_002828454.1 nicotinamide riboside transporter PnuC -
  G9U56_RS06515 (G9U56_06465) - 1284075..1284260 (-) 186 WP_002828455.1 hypothetical protein -
  G9U56_RS06520 (G9U56_06470) - 1284260..1284886 (-) 627 WP_277375506.1 hypothetical protein -
  G9U56_RS06525 (G9U56_06475) - 1284886..1285125 (-) 240 WP_284566575.1 hypothetical protein -
  G9U56_RS06530 (G9U56_06480) - 1285169..1285606 (-) 438 WP_277375508.1 dTDP-glucose pyrophosphorylase -
  G9U56_RS06535 (G9U56_06485) - 1285594..1285764 (-) 171 WP_277375509.1 hypothetical protein -
  G9U56_RS06540 (G9U56_06490) - 1285767..1286492 (-) 726 WP_277375510.1 ATP-binding protein -
  G9U56_RS06545 (G9U56_06495) - 1286479..1287357 (-) 879 WP_259705399.1 phage replisome organizer N-terminal domain-containing protein -
  G9U56_RS06550 (G9U56_06500) ssb 1287368..1287895 (-) 528 WP_277375511.1 single-stranded DNA-binding protein Machinery gene
  G9U56_RS06555 (G9U56_06505) - 1287858..1288568 (-) 711 WP_277375513.1 putative HNHc nuclease -
  G9U56_RS06560 (G9U56_06510) - 1288568..1289209 (-) 642 WP_277375514.1 ERF family protein -
  G9U56_RS06565 (G9U56_06515) - 1289193..1289387 (-) 195 WP_277375515.1 hypothetical protein -
  G9U56_RS06570 (G9U56_06520) - 1289453..1289659 (-) 207 WP_277375516.1 helix-turn-helix transcriptional regulator -
  G9U56_RS06575 (G9U56_06525) - 1289663..1290022 (-) 360 WP_277375517.1 hypothetical protein -
  G9U56_RS06580 (G9U56_06530) - 1290136..1290345 (-) 210 WP_277375518.1 hypothetical protein -
  G9U56_RS06585 (G9U56_06535) - 1290347..1290541 (-) 195 WP_140837452.1 hypothetical protein -
  G9U56_RS06590 (G9U56_06540) - 1290659..1290871 (+) 213 WP_277375519.1 hypothetical protein -
  G9U56_RS06595 (G9U56_06545) - 1291210..1291695 (+) 486 WP_284566576.1 hypothetical protein -
  G9U56_RS06600 (G9U56_06550) - 1291825..1292550 (-) 726 WP_277375521.1 Rha family transcriptional regulator -
  G9U56_RS06605 (G9U56_06555) - 1292569..1292796 (-) 228 WP_040760834.1 helix-turn-helix domain-containing protein -
  G9U56_RS06610 (G9U56_06560) - 1293061..1293411 (+) 351 WP_277375522.1 helix-turn-helix transcriptional regulator -
  G9U56_RS06615 (G9U56_06565) - 1293487..1293978 (+) 492 WP_277375523.1 hypothetical protein -
  G9U56_RS06620 (G9U56_06570) - 1294056..1294712 (+) 657 WP_277375524.1 Ltp family lipoprotein -
  G9U56_RS06625 (G9U56_06575) - 1294882..1295958 (+) 1077 WP_277375526.1 site-specific integrase -
  G9U56_RS06635 (G9U56_06585) - 1296253..1296759 (-) 507 WP_150177836.1 antibiotic biosynthesis monooxygenase -
  G9U56_RS06640 (G9U56_06590) - 1296853..1297581 (-) 729 WP_002828485.1 type II CAAX endopeptidase family protein -
  G9U56_RS06645 (G9U56_06595) - 1297568..1297774 (-) 207 WP_040760843.1 hypothetical protein -
  G9U56_RS06650 (G9U56_06600) - 1297779..1298615 (-) 837 WP_002828487.1 Cof-type HAD-IIB family hydrolase -
  G9U56_RS06655 (G9U56_06605) mscL 1298795..1299187 (+) 393 WP_277375527.1 large conductance mechanosensitive channel protein MscL -
  G9U56_RS06660 (G9U56_06610) - 1299378..1300016 (+) 639 WP_002828489.1 deoxynucleoside kinase -
  G9U56_RS06665 (G9U56_06615) - 1300089..1301513 (-) 1425 WP_277362326.1 C40 family peptidase -

Sequence


Protein


Download         Length: 175 a.a.        Molecular weight: 19659.59 Da        Isoelectric Point: 9.8781

>NTDB_id=428876 G9U56_RS06550 WP_277375511.1 1287368..1287895(-) (ssb) [Weissella paramesenteroides strain W31]
MINNVTLTGRLTKDMELKYTTSGTAVASATVAVERSFTDGNGERGSDFINFVIWRKAAENMAKMTAKGSLIGLEGRLQTR
SYDNQQRQKVFVTEVVVNNFSLLESKEVTDQRKQGGVSQPQQNNFNQQPQRQNNFNQQQAPQGNFNQQRQQPQQNNFGGS
QGYGNGNNFEDQLPF

Nucleotide


Download         Length: 528 bp        

>NTDB_id=428876 G9U56_RS06550 WP_277375511.1 1287368..1287895(-) (ssb) [Weissella paramesenteroides strain W31]
ATGATAAACAACGTCACACTAACTGGCAGACTAACTAAAGATATGGAGTTGAAATATACCACGTCAGGTACAGCCGTAGC
CAGTGCAACAGTAGCAGTTGAACGTTCATTTACTGACGGTAATGGTGAACGAGGTAGTGACTTTATTAACTTTGTTATTT
GGCGTAAGGCGGCTGAAAATATGGCAAAAATGACCGCTAAAGGTTCATTGATTGGACTGGAAGGACGTTTGCAAACACGT
AGCTATGATAACCAGCAAAGGCAAAAAGTATTCGTTACCGAAGTAGTTGTTAATAATTTCTCGTTATTAGAAAGCAAGGA
AGTGACTGACCAACGTAAGCAAGGTGGGGTTAGTCAACCACAGCAAAATAACTTTAATCAACAGCCACAGCGACAAAACA
ATTTCAACCAACAGCAAGCACCACAAGGAAACTTCAATCAACAACGCCAACAACCACAACAAAATAATTTTGGTGGATCA
CAGGGATATGGCAACGGCAATAACTTTGAAGACCAATTGCCGTTCTAG


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  ssb Latilactobacillus sakei subsp. sakei 23K

51.934

100

0.537

  ssbA Bacillus subtilis subsp. subtilis str. 168

59.434

60.571

0.36