Detailed information    

insolico Bioinformatically predicted

Overview

Name   degQ   Type   Regulator
Locus tag   V753_RS14530 Genome accession   NZ_CP049904
Coordinates   2977299..2977439 (-) Length   46 a.a.
NCBI ID   WP_003152043.1    Uniprot ID   A3KLB4
Organism   Bacillus velezensis strain GB03     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context

Location: 2972299..2982439
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  V753_RS14505 (V753_14475) - 2972642..2973025 (-) 384 WP_007613430.1 hotdog fold thioesterase -
  V753_RS14510 (V753_14480) comA 2973047..2973691 (-) 645 WP_003152052.1 response regulator transcription factor Regulator
  V753_RS14515 (V753_14485) comP 2973772..2976060 (-) 2289 WP_007613431.1 histidine kinase Regulator
  V753_RS14520 (V753_14490) comX 2976072..2976236 (-) 165 WP_007613432.1 competence pheromone ComX -
  V753_RS14525 (V753_14495) - 2976236..2977147 (-) 912 WP_007613433.1 polyprenyl synthetase family protein -
  V753_RS14530 (V753_14500) degQ 2977299..2977439 (-) 141 WP_003152043.1 degradation enzyme regulation protein DegQ Regulator
  V753_RS14535 (V753_14505) - 2977905..2978246 (+) 342 WP_007613435.1 hypothetical protein -
  V753_RS14540 (V753_14510) - 2978253..2979476 (-) 1224 WP_007613436.1 EAL and HDOD domain-containing protein -
  V753_RS14545 (V753_14515) - 2979606..2981072 (-) 1467 WP_014418767.1 nicotinate phosphoribosyltransferase -
  V753_RS14550 (V753_14520) - 2981090..2981641 (-) 552 WP_003152033.1 cysteine hydrolase family protein -
  V753_RS14555 (V753_14525) - 2981738..2982136 (-) 399 WP_007613438.1 YueI family protein -

Sequence

Protein


Download         Length: 46 a.a.        Molecular weight: 5518.30 Da        Isoelectric Point: 4.9432

>NTDB_id=428522 V753_RS14530 WP_003152043.1 2977299..2977439(-) (degQ) [Bacillus velezensis strain GB03]
MENKLEEVKQLLFRLENDIRETTDSLRNINKSIDQLDKFSYAMKIS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=428522 V753_RS14530 WP_003152043.1 2977299..2977439(-) (degQ) [Bacillus velezensis strain GB03]
GTGGAAAACAAATTAGAAGAAGTAAAGCAATTATTATTCCGACTTGAAAATGATATCAGAGAAACAACCGACTCATTACG
AAACATTAACAAAAGCATTGATCAGCTCGATAAATTCTCATATGCAATGAAAATTTCTTAA

Domains

Predicted by InterproScan.

DegQ (SacQ) family (DegQ)

(1-46)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB A3KLB4

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

89.13

100

0.891