Detailed information    

insolico Bioinformatically predicted

Overview


Name   phrC   Type   Regulator
Locus tag   V753_RS02005 Genome accession   NZ_CP049904
Coordinates   395799..395918 (+) Length   39 a.a.
NCBI ID   WP_003156334.1    Uniprot ID   I2C1C3
Organism   Bacillus velezensis strain GB03     
Function   antagonize RapC (predicted from homology)   
Competence regulation

Genomic Context


Location: 390799..400918
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  V753_RS01990 (V753_01980) - 392411..393094 (+) 684 WP_007609386.1 response regulator transcription factor -
  V753_RS01995 (V753_01985) - 393081..394514 (+) 1434 WP_161631122.1 sensor histidine kinase -
  V753_RS02000 (V753_01990) rapC 394667..395815 (+) 1149 WP_029326229.1 Rap family tetratricopeptide repeat protein Regulator
  V753_RS02005 (V753_01995) phrC 395799..395918 (+) 120 WP_003156334.1 PhrC/PhrF family phosphatase-inhibitory pheromone Regulator
  V753_RS02010 (V753_02000) - 396067..396177 (-) 111 WP_369719092.1 YjcZ family sporulation protein -
  V753_RS02015 (V753_02005) - 396257..397621 (-) 1365 WP_007609394.1 aspartate kinase -
  V753_RS02020 (V753_02010) ceuB 398035..398988 (+) 954 WP_007609397.1 ABC transporter permease Machinery gene
  V753_RS02025 (V753_02015) - 398978..399925 (+) 948 WP_003156331.1 iron chelate uptake ABC transporter family permease subunit -
  V753_RS02030 (V753_02020) - 399919..400677 (+) 759 WP_007609404.1 ABC transporter ATP-binding protein -

Sequence


Protein


Download         Length: 39 a.a.        Molecular weight: 4228.96 Da        Isoelectric Point: 8.0285

>NTDB_id=428471 V753_RS02005 WP_003156334.1 395799..395918(+) (phrC) [Bacillus velezensis strain GB03]
MKLKSKWFVICLAAAAIFTVTGAGQTDQAEFHVAERGMT

Nucleotide


Download         Length: 120 bp        

>NTDB_id=428471 V753_RS02005 WP_003156334.1 395799..395918(+) (phrC) [Bacillus velezensis strain GB03]
ATGAAATTGAAATCTAAATGGTTTGTTATTTGTTTAGCAGCCGCCGCGATTTTTACAGTGACAGGAGCAGGCCAGACAGA
TCAGGCTGAATTCCATGTAGCTGAAAGAGGAATGACGTGA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB I2C1C3

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  phrC Bacillus subtilis subsp. subtilis str. 168

70

100

0.718