Detailed information    

insolico Bioinformatically predicted

Overview


Name   comGG   Type   Machinery gene
Locus tag   G7X27_RS11645 Genome accession   NZ_CP049741
Coordinates   2438952..2439329 (-) Length   125 a.a.
NCBI ID   WP_032874019.1    Uniprot ID   -
Organism   Bacillus velezensis strain UB2017     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 2433952..2444329
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  G7X27_RS11605 - 2434449..2435243 (+) 795 WP_007612541.1 YqhG family protein -
  G7X27_RS11610 sinI 2435420..2435593 (+) 174 WP_032874029.1 anti-repressor SinI family protein Regulator
  G7X27_RS11615 sinR 2435627..2435962 (+) 336 WP_003153104.1 transcriptional regulator SinR Regulator
  G7X27_RS11620 - 2436010..2436795 (-) 786 WP_032874027.1 TasA family protein -
  G7X27_RS11625 - 2436860..2437444 (-) 585 WP_032874025.1 signal peptidase I -
  G7X27_RS11630 tapA 2437416..2438087 (-) 672 WP_032874023.1 amyloid fiber anchoring/assembly protein TapA -
  G7X27_RS11635 - 2438346..2438675 (+) 330 WP_032874021.1 DUF3889 domain-containing protein -
  G7X27_RS11640 - 2438716..2438895 (-) 180 WP_022552966.1 YqzE family protein -
  G7X27_RS11645 comGG 2438952..2439329 (-) 378 WP_032874019.1 competence type IV pilus minor pilin ComGG Machinery gene
  G7X27_RS11650 comGF 2439330..2439830 (-) 501 WP_223204419.1 competence type IV pilus minor pilin ComGF -
  G7X27_RS11655 comGE 2439739..2440053 (-) 315 WP_032874016.1 competence type IV pilus minor pilin ComGE Machinery gene
  G7X27_RS11660 comGD 2440037..2440474 (-) 438 WP_007612572.1 competence type IV pilus minor pilin ComGD Machinery gene
  G7X27_RS11665 comGC 2440464..2440730 (-) 267 WP_042635730.1 competence type IV pilus major pilin ComGC Machinery gene
  G7X27_RS11670 comGB 2440777..2441814 (-) 1038 WP_032874014.1 competence type IV pilus assembly protein ComGB Machinery gene
  G7X27_RS11675 comGA 2441801..2442871 (-) 1071 WP_003153083.1 competence type IV pilus ATPase ComGA Machinery gene
  G7X27_RS11680 - 2443068..2444018 (-) 951 WP_032874012.1 magnesium transporter CorA family protein -

Sequence


Protein


Download         Length: 125 a.a.        Molecular weight: 14077.01 Da        Isoelectric Point: 10.2236

>NTDB_id=427549 G7X27_RS11645 WP_032874019.1 2438952..2439329(-) (comGG) [Bacillus velezensis strain UB2017]
MSKSDGFIYPAVLFVSAAVLLVISYTSSDFITRKTFAKEAGEYWIGENLLQNGALLSSRHMAQGKKARTGTQRFPYGTVS
FHISGSDRRETVQVTIQTETTTGTRREAHLLFDQKKKQLIQWTEV

Nucleotide


Download         Length: 378 bp        

>NTDB_id=427549 G7X27_RS11645 WP_032874019.1 2438952..2439329(-) (comGG) [Bacillus velezensis strain UB2017]
ATGTCCAAATCTGACGGTTTTATATATCCCGCGGTTCTGTTTGTTTCTGCCGCAGTTTTACTTGTCATCAGCTATACTTC
ATCTGATTTCATCACCCGAAAAACATTTGCAAAAGAGGCAGGGGAGTACTGGATCGGAGAGAACCTGCTCCAAAACGGCG
CGCTGCTGTCAAGCCGCCATATGGCACAGGGAAAAAAGGCCCGAACTGGTACACAGCGTTTTCCGTATGGCACCGTTTCT
TTTCACATCTCCGGGAGTGATCGCCGGGAAACGGTTCAGGTTACAATTCAGACGGAAACCACGACAGGTACGAGACGGGA
GGCTCACCTTTTGTTCGATCAGAAGAAGAAACAGCTGATTCAATGGACGGAAGTATAA

Domains


Predicted by InterproScan.

(30-124)


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGG Bacillus subtilis subsp. subtilis str. 168

49.194

99.2

0.488