Detailed information    

insolico Bioinformatically predicted

Overview

Name   sinI   Type   Regulator
Locus tag   G7X27_RS11610 Genome accession   NZ_CP049741
Coordinates   2435420..2435593 (+) Length   57 a.a.
NCBI ID   WP_032874029.1    Uniprot ID   -
Organism   Bacillus velezensis strain UB2017     
Function   inhibit the expression of sinR (predicted from homology)   
Competence regulation

Genomic Context

Location: 2430420..2440593
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  G7X27_RS11595 gcvT 2431234..2432334 (-) 1101 WP_032874033.1 glycine cleavage system aminomethyltransferase GcvT -
  G7X27_RS11600 - 2432757..2434427 (+) 1671 WP_032874031.1 SNF2-related protein -
  G7X27_RS11605 - 2434449..2435243 (+) 795 WP_007612541.1 YqhG family protein -
  G7X27_RS11610 sinI 2435420..2435593 (+) 174 WP_032874029.1 anti-repressor SinI family protein Regulator
  G7X27_RS11615 sinR 2435627..2435962 (+) 336 WP_003153104.1 transcriptional regulator SinR Regulator
  G7X27_RS11620 - 2436010..2436795 (-) 786 WP_032874027.1 TasA family protein -
  G7X27_RS11625 - 2436860..2437444 (-) 585 WP_032874025.1 signal peptidase I -
  G7X27_RS11630 tapA 2437416..2438087 (-) 672 WP_032874023.1 amyloid fiber anchoring/assembly protein TapA -
  G7X27_RS11635 - 2438346..2438675 (+) 330 WP_032874021.1 DUF3889 domain-containing protein -
  G7X27_RS11640 - 2438716..2438895 (-) 180 WP_022552966.1 YqzE family protein -
  G7X27_RS11645 comGG 2438952..2439329 (-) 378 WP_032874019.1 competence type IV pilus minor pilin ComGG Machinery gene
  G7X27_RS11650 comGF 2439330..2439830 (-) 501 WP_223204419.1 competence type IV pilus minor pilin ComGF -
  G7X27_RS11655 comGE 2439739..2440053 (-) 315 WP_032874016.1 competence type IV pilus minor pilin ComGE Machinery gene
  G7X27_RS11660 comGD 2440037..2440474 (-) 438 WP_007612572.1 competence type IV pilus minor pilin ComGD Machinery gene

Sequence

Protein


Download         Length: 57 a.a.        Molecular weight: 6658.66 Da        Isoelectric Point: 9.8168

>NTDB_id=427547 G7X27_RS11610 WP_032874029.1 2435420..2435593(+) (sinI) [Bacillus velezensis strain UB2017]
MKNAKMEFSQLDKEWVELILEAQKANISLEEIRKYLLSNKKSSQHVQAARSHTVNPF

Nucleotide


Download         Length: 174 bp        

>NTDB_id=427547 G7X27_RS11610 WP_032874029.1 2435420..2435593(+) (sinI) [Bacillus velezensis strain UB2017]
ATGAAAAATGCAAAAATGGAATTTTCGCAATTAGATAAGGAATGGGTTGAGCTGATATTAGAAGCCCAAAAAGCAAATAT
CAGCCTAGAAGAAATACGCAAATACCTGCTTTCGAATAAAAAGTCTTCTCAACATGTCCAGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA

Domains

Predicted by InterproScan.

Anti-repressor SinI (SinI)

(11-37)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sinI Bacillus subtilis subsp. subtilis str. 168

71.93

100

0.719