Detailed information    

insolico Bioinformatically predicted

Overview

Name   degQ   Type   Regulator
Locus tag   GYO_RS38065 Genome accession   NC_016047
Coordinates   3199090..3199230 (-) Length   46 a.a.
NCBI ID   WP_003220708.1    Uniprot ID   G4P060
Organism   Bacillus spizizenii TU-B-10     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context

Location: 3194090..3204230
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  GYO_RS38040 (GYO_3457) - 3194369..3194749 (-) 381 WP_003220719.1 hotdog fold thioesterase -
  GYO_RS38045 (GYO_3458) comA 3194765..3195409 (-) 645 WP_003220716.1 two-component system response regulator ComA Regulator
  GYO_RS38050 (GYO_3459) comP 3195490..3197802 (-) 2313 WP_014114982.1 histidine kinase Regulator
  GYO_RS38055 (GYO_3460) comX 3197818..3198039 (-) 222 WP_014114983.1 competence pheromone ComX -
  GYO_RS38060 (GYO_3461) - 3198036..3198905 (-) 870 WP_014114984.1 polyprenyl synthetase family protein -
  GYO_RS38065 (GYO_3462) degQ 3199090..3199230 (-) 141 WP_003220708.1 degradation enzyme regulation protein DegQ Regulator
  GYO_RS43830 (GYO_3463) - 3199452..3199577 (+) 126 WP_014114985.1 hypothetical protein -
  GYO_RS38070 (GYO_3464) - 3199692..3200060 (+) 369 WP_014114986.1 hypothetical protein -
  GYO_RS38075 (GYO_3465) pdeH 3200036..3201265 (-) 1230 WP_014114987.1 cyclic di-GMP phosphodiesterase -
  GYO_RS38080 (GYO_3466) - 3201401..3202873 (-) 1473 WP_014114988.1 nicotinate phosphoribosyltransferase -
  GYO_RS38085 (GYO_3467) - 3202889..3203440 (-) 552 WP_014114989.1 cysteine hydrolase family protein -
  GYO_RS38090 (GYO_3468) - 3203537..3203935 (-) 399 WP_014114990.1 YueI family protein -

Sequence

Protein


Download         Length: 46 a.a.        Molecular weight: 5546.44 Da        Isoelectric Point: 6.2559

>NTDB_id=42612 GYO_RS38065 WP_003220708.1 3199090..3199230(-) (degQ) [Bacillus spizizenii TU-B-10]
MEKKLEEVKQLLFRLELDIKETTDSLRNINKSIDQLDKYNYAMKIS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=42612 GYO_RS38065 WP_003220708.1 3199090..3199230(-) (degQ) [Bacillus spizizenii TU-B-10]
ATGGAAAAGAAACTTGAAGAAGTAAAACAATTGTTATTCCGACTCGAACTTGATATTAAAGAAACGACAGATTCATTACG
AAACATTAACAAAAGCATTGATCAGCTCGATAAATACAATTACGCAATGAAAATTTCGTGA

Domains

Predicted by InterproScan.

DegQ (SacQ) family (DegQ)

(1-46)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB G4P060

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

100

100

1

Multiple sequence alignment