Detailed information    

insolico Bioinformatically predicted

Overview

Name   sinI   Type   Regulator
Locus tag   G6536_RS13215 Genome accession   NZ_CP049330
Coordinates   2567528..2567704 (+) Length   58 a.a.
NCBI ID   WP_003183444.1    Uniprot ID   -
Organism   Bacillus licheniformis strain CP6     
Function   inhibit the expression of sinR (predicted from homology)   
Competence regulation

Genomic Context

Location: 2562528..2572704
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  G6536_RS13200 (G6536_13390) gcvT 2563170..2564264 (-) 1095 WP_098408292.1 glycine cleavage system aminomethyltransferase GcvT -
  G6536_RS13205 (G6536_13395) - 2564857..2566536 (+) 1680 WP_003183439.1 SNF2-related protein -
  G6536_RS13210 (G6536_13400) - 2566543..2567337 (+) 795 WP_003183441.1 YqhG family protein -
  G6536_RS13215 (G6536_13405) sinI 2567528..2567704 (+) 177 WP_003183444.1 anti-repressor SinI family protein Regulator
  G6536_RS13220 (G6536_13410) sinR 2567738..2568073 (+) 336 WP_025804940.1 helix-turn-helix domain-containing protein Regulator
  G6536_RS13225 (G6536_13415) - 2568178..2568972 (-) 795 WP_003183447.1 TasA family protein -
  G6536_RS13230 (G6536_13420) - 2569046..2569630 (-) 585 WP_003183449.1 signal peptidase I -
  G6536_RS13235 (G6536_13425) tapA 2569627..2570355 (-) 729 WP_003183451.1 amyloid fiber anchoring/assembly protein TapA -
  G6536_RS13240 (G6536_13430) - 2570665..2570952 (+) 288 WP_223307118.1 YqzG/YhdC family protein -
  G6536_RS13245 (G6536_13435) - 2570976..2571158 (-) 183 WP_003183456.1 YqzE family protein -
  G6536_RS13250 (G6536_13440) comGG 2571247..2571612 (-) 366 WP_003183459.1 competence type IV pilus minor pilin ComGG -
  G6536_RS13255 (G6536_13445) comGF 2571625..2572113 (-) 489 WP_011201694.1 competence type IV pilus minor pilin ComGF -
  G6536_RS13260 (G6536_13450) comGE 2572022..2572369 (-) 348 WP_009327907.1 competence type IV pilus minor pilin ComGE -

Sequence

Protein


Download         Length: 58 a.a.        Molecular weight: 6724.47 Da        Isoelectric Point: 4.7616

>NTDB_id=426102 G6536_RS13215 WP_003183444.1 2567528..2567704(+) (sinI) [Bacillus licheniformis strain CP6]
MNKDKNEKEELDEEWTDLIKHALEQGISPEEIRIFLNLGKKSSNPSTSIERSHSINPF

Nucleotide


Download         Length: 177 bp        

>NTDB_id=426102 G6536_RS13215 WP_003183444.1 2567528..2567704(+) (sinI) [Bacillus licheniformis strain CP6]
ATGAATAAAGATAAAAATGAGAAAGAAGAATTGGATGAGGAGTGGACAGACTTGATTAAACACGCTCTTGAACAAGGCAT
TAGTCCAGAGGAAATACGTATTTTTCTCAATTTGGGAAAGAAGTCTTCAAATCCTTCCACATCAATTGAAAGAAGTCATT
CAATAAATCCTTTCTGA

Domains

Predicted by InterproScan.

Anti-repressor SinI (SinI)

(11-37)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sinI Bacillus subtilis subsp. subtilis str. 168

51.724

100

0.517