Detailed information    

insolico Bioinformatically predicted

Overview


Name   comB7   Type   Machinery gene
Locus tag   HPSH112_RS00210 Genome accession   NC_017741
Coordinates   35524..35637 (+) Length   37 a.a.
NCBI ID   WP_001217864.1    Uniprot ID   -
Organism   Helicobacter pylori Shi112     
Function   transformation-associated type IV transport system (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 30524..40637
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  HPSH112_RS00185 (HPSH112_00160) - 30586..32808 (+) 2223 WP_001051544.1 AAA family ATPase -
  HPSH112_RS00190 (HPSH112_00165) panD 32798..33148 (+) 351 WP_000142269.1 aspartate 1-decarboxylase -
  HPSH112_RS00195 (HPSH112_00170) - 33159..33452 (+) 294 WP_000347917.1 YbaB/EbfC family nucleoid-associated protein -
  HPSH112_RS00200 (HPSH112_00175) - 33452..34447 (+) 996 WP_000468441.1 PDZ domain-containing protein -
  HPSH112_RS00205 (HPSH112_00180) comB6 34453..35508 (+) 1056 WP_000786694.1 P-type conjugative transfer protein TrbL Machinery gene
  HPSH112_RS00210 comB7 35524..35637 (+) 114 WP_001217864.1 hypothetical protein Machinery gene
  HPSH112_RS00215 (HPSH112_00185) comB8 35634..36377 (+) 744 WP_000660502.1 type IV secretion system protein Machinery gene
  HPSH112_RS00220 (HPSH112_00190) comB9 36377..37333 (+) 957 WP_014662053.1 TrbG/VirB9 family P-type conjugative transfer protein Machinery gene
  HPSH112_RS00225 (HPSH112_00195) comB10 37326..38462 (+) 1137 WP_001045868.1 DNA type IV secretion system protein ComB10 Machinery gene
  HPSH112_RS00230 (HPSH112_00200) - 38534..39946 (+) 1413 WP_000694836.1 mannose-1-phosphate guanylyltransferase/mannose-6-phosphate isomerase -

Sequence


Protein


Download         Length: 37 a.a.        Molecular weight: 4305.26 Da        Isoelectric Point: 9.3572

>NTDB_id=42469 HPSH112_RS00210 WP_001217864.1 35524..35637(+) (comB7) [Helicobacter pylori Shi112]
MRIFFVIIGIMLFGCTSKVHEMKKSPCTLYENRLNLA

Nucleotide


Download         Length: 114 bp        

>NTDB_id=42469 HPSH112_RS00210 WP_001217864.1 35524..35637(+) (comB7) [Helicobacter pylori Shi112]
ATGAGAATTTTTTTTGTTATTATAGGAATCATGTTATTTGGTTGCACCAGTAAGGTGCATGAGATGAAAAAAAGCCCTTG
CACACTGTATGAAAACAGGTTAAATCTCGCATGA

Domains



No domain identified.



Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comB7 Helicobacter pylori P1

89.189

100

0.892