Detailed information    

insolico Bioinformatically predicted

Overview


Name   comB7   Type   Machinery gene
Locus tag   HPSH417_RS08005 Genome accession   NC_017739
Coordinates   33597..33710 (+) Length   37 a.a.
NCBI ID   WP_001217864.1    Uniprot ID   -
Organism   Helicobacter pylori Shi417     
Function   transformation-associated type IV transport system (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 28597..38710
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  HPSH417_RS00165 (HPSH417_00150) - 28636..30858 (+) 2223 WP_001051545.1 AAA family ATPase -
  HPSH417_RS00170 (HPSH417_00155) panD 30848..31198 (+) 351 WP_000142504.1 aspartate 1-decarboxylase -
  HPSH417_RS00175 (HPSH417_00160) - 31209..31511 (+) 303 WP_000347918.1 YbaB/EbfC family nucleoid-associated protein -
  HPSH417_RS00180 (HPSH417_00165) - 31511..32518 (+) 1008 WP_000468453.1 PDZ domain-containing protein -
  HPSH417_RS00185 (HPSH417_00170) comB6 32526..33581 (+) 1056 WP_000786671.1 P-type conjugative transfer protein TrbL Machinery gene
  HPSH417_RS08005 comB7 33597..33710 (+) 114 WP_001217864.1 hypothetical protein Machinery gene
  HPSH417_RS00190 (HPSH417_00175) comB8 33707..34450 (+) 744 WP_000660502.1 type IV secretion system protein Machinery gene
  HPSH417_RS00195 (HPSH417_00180) comB9 34450..35415 (+) 966 WP_014661897.1 TrbG/VirB9 family P-type conjugative transfer protein Machinery gene
  HPSH417_RS00200 (HPSH417_00185) comB10 35408..36544 (+) 1137 WP_001045876.1 DNA type IV secretion system protein ComB10 Machinery gene
  HPSH417_RS00205 (HPSH417_00190) - 36614..38026 (+) 1413 WP_000694822.1 mannose-1-phosphate guanylyltransferase/mannose-6-phosphate isomerase -

Sequence


Protein


Download         Length: 37 a.a.        Molecular weight: 4305.26 Da        Isoelectric Point: 9.3572

>NTDB_id=42422 HPSH417_RS08005 WP_001217864.1 33597..33710(+) (comB7) [Helicobacter pylori Shi417]
MRIFFVIIGIMLFGCTSKVHEMKKSPCTLYENRLNLA

Nucleotide


Download         Length: 114 bp        

>NTDB_id=42422 HPSH417_RS08005 WP_001217864.1 33597..33710(+) (comB7) [Helicobacter pylori Shi417]
ATGAGAATTTTTTTTGTTATTATAGGAATCATGTTATTTGGTTGCACCAGTAAGGTGCATGAGATGAAAAAAAGCCCTTG
CACACTGTATGAAAACAGGTTGAATCTTGCATGA

Domains



No domain identified.



Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comB7 Helicobacter pylori P1

89.189

100

0.892