Detailed information
Overview
| Name | pilK | Type | Machinery gene |
| Locus tag | G4V52_RS02330 | Genome accession | NZ_CP048905 |
| Coordinates | 450295..450906 (+) | Length | 203 a.a. |
| NCBI ID | WP_003687918.1 | Uniprot ID | - |
| Organism | Neisseria gonorrhoeae strain SRRSH205 | ||
| Function | type IV pilus (predicted from homology) DNA binding and uptake |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 446470..508603 | 450295..450906 | within | 0 |
Gene organization within MGE regions
Location: 446470..508603
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| G4V52_RS02310 | dnaB | 446470..447876 (+) | 1407 | WP_047917169.1 | replicative DNA helicase | - |
| G4V52_RS02315 | pilH | 448031..448696 (+) | 666 | WP_047918678.1 | Tfp pilus assembly protein FimT/FimU | Machinery gene |
| G4V52_RS02320 | pilV | 448728..449339 (+) | 612 | WP_050169631.1 | type IV pilus modification protein PilV | Machinery gene |
| G4V52_RS02325 | pilJ | 449336..450316 (+) | 981 | WP_203029633.1 | PilW family protein | Machinery gene |
| G4V52_RS02330 | pilK | 450295..450906 (+) | 612 | WP_003687918.1 | pilus assembly protein | Machinery gene |
| G4V52_RS02335 | pilL | 450908..451384 (+) | 477 | WP_203004379.1 | PilX family type IV pilin | Machinery gene |
| G4V52_RS02340 | - | 451454..451762 (-) | 309 | WP_010951048.1 | AzlD family protein | - |
| G4V52_RS02345 | - | 451759..452466 (-) | 708 | Protein_460 | AzlC family ABC transporter permease | - |
| G4V52_RS02350 | dut | 452632..453084 (+) | 453 | WP_103195211.1 | dUTP diphosphatase | - |
| G4V52_RS02355 | dapC | 453162..454349 (+) | 1188 | WP_047949582.1 | succinyldiaminopimelate transaminase | - |
| G4V52_RS02360 | yaaA | 454660..455439 (+) | 780 | WP_003706583.1 | peroxide stress protein YaaA | - |
| G4V52_RS02375 | - | 455970..457163 (+) | 1194 | WP_010359935.1 | integrase arm-type DNA-binding domain-containing protein | - |
| G4V52_RS02380 | - | 457519..457788 (-) | 270 | WP_003687928.1 | hypothetical protein | - |
| G4V52_RS02385 | - | 457983..458666 (-) | 684 | WP_003687929.1 | DUF2786 domain-containing protein | - |
| G4V52_RS12525 | - | 458980..459213 (-) | 234 | Protein_467 | hypothetical protein | - |
| G4V52_RS02395 | - | 459324..459539 (-) | 216 | WP_003691538.1 | hypothetical protein | - |
| G4V52_RS02400 | - | 459591..460082 (-) | 492 | WP_003691537.1 | siphovirus Gp157 family protein | - |
| G4V52_RS02405 | - | 460079..460261 (-) | 183 | WP_003691535.1 | hypothetical protein | - |
| G4V52_RS02410 | - | 460401..461087 (-) | 687 | WP_050159915.1 | hypothetical protein | - |
| G4V52_RS02415 | - | 461156..461317 (-) | 162 | WP_003693867.1 | hypothetical protein | - |
| G4V52_RS02420 | - | 461314..461592 (-) | 279 | WP_003691529.1 | hypothetical protein | - |
| G4V52_RS02425 | - | 461745..462077 (-) | 333 | WP_003687946.1 | hypothetical protein | - |
| G4V52_RS02430 | - | 462218..462493 (-) | 276 | WP_103195391.1 | hypothetical protein | - |
| G4V52_RS02435 | - | 462490..462966 (-) | 477 | WP_002255718.1 | hypothetical protein | - |
| G4V52_RS02440 | - | 462999..463199 (-) | 201 | WP_047954343.1 | hypothetical protein | - |
| G4V52_RS02445 | - | 463397..463810 (-) | 414 | WP_003687963.1 | hypothetical protein | - |
| G4V52_RS02450 | - | 463807..464268 (-) | 462 | WP_003687965.1 | helix-turn-helix transcriptional regulator | - |
| G4V52_RS02455 | - | 464285..464722 (-) | 438 | WP_003687967.1 | hypothetical protein | - |
| G4V52_RS02460 | - | 464835..465551 (-) | 717 | WP_003687969.1 | LexA family transcriptional regulator | - |
| G4V52_RS02465 | - | 465620..465856 (+) | 237 | WP_003687971.1 | Cro/CI family transcriptional regulator | - |
| G4V52_RS02470 | - | 465936..466091 (+) | 156 | WP_003689578.1 | hypothetical protein | - |
| G4V52_RS02475 | - | 466068..466256 (-) | 189 | WP_003691445.1 | hypothetical protein | - |
| G4V52_RS02480 | - | 466429..466656 (+) | 228 | WP_003698261.1 | helix-turn-helix domain-containing protein | - |
| G4V52_RS02485 | - | 466653..466790 (+) | 138 | WP_010359998.1 | hypothetical protein | - |
| G4V52_RS12005 | - | 467335..467838 (+) | 504 | WP_010360005.1 | hypothetical protein | - |
| G4V52_RS02495 | - | 467835..469196 (+) | 1362 | WP_003689132.1 | DnaB-like helicase C-terminal domain-containing protein | - |
| G4V52_RS02500 | - | 469213..469458 (+) | 246 | WP_203029634.1 | hypothetical protein | - |
| G4V52_RS02505 | - | 469533..470027 (+) | 495 | WP_115067539.1 | DUF3310 domain-containing protein | - |
| G4V52_RS02510 | - | 470204..470353 (+) | 150 | WP_003689110.1 | hypothetical protein | - |
| G4V52_RS12010 | - | 470381..470662 (+) | 282 | WP_003689109.1 | hypothetical protein | - |
| G4V52_RS02515 | - | 470653..471033 (+) | 381 | WP_033911195.1 | RusA family crossover junction endodeoxyribonuclease | - |
| G4V52_RS12385 | - | 471050..471178 (-) | 129 | WP_012503747.1 | hypothetical protein | - |
| G4V52_RS02520 | - | 471300..471707 (+) | 408 | WP_003691430.1 | hypothetical protein | - |
| G4V52_RS02525 | - | 471798..472958 (+) | 1161 | WP_003691428.1 | type I restriction endonuclease | - |
| G4V52_RS02530 | - | 473239..474108 (+) | 870 | WP_103195306.1 | BRO family protein | - |
| G4V52_RS02535 | - | 474401..474850 (+) | 450 | WP_003695485.1 | hypothetical protein | - |
| G4V52_RS02540 | terL | 474912..476333 (+) | 1422 | WP_003697216.1 | phage terminase large subunit | - |
| G4V52_RS02545 | - | 476330..478477 (+) | 2148 | WP_003691423.1 | phage portal protein | - |
| G4V52_RS02550 | - | 478545..479702 (+) | 1158 | WP_047918052.1 | HK97 family phage prohead protease | - |
| G4V52_RS02555 | - | 479743..481242 (+) | 1500 | WP_003691419.1 | hypothetical protein | - |
| G4V52_RS02560 | - | 481249..481602 (+) | 354 | WP_047920932.1 | hypothetical protein | - |
| G4V52_RS02565 | - | 481605..482135 (+) | 531 | WP_003689080.1 | head-tail connector protein | - |
| G4V52_RS02570 | - | 482135..482617 (+) | 483 | WP_041421297.1 | HK97 gp10 family phage protein | - |
| G4V52_RS02575 | - | 482614..483042 (+) | 429 | WP_003689076.1 | hypothetical protein | - |
| G4V52_RS02580 | - | 483068..483841 (+) | 774 | WP_003692869.1 | hypothetical protein | - |
| G4V52_RS02585 | - | 483902..484231 (+) | 330 | WP_003692871.1 | hypothetical protein | - |
| G4V52_RS02590 | - | 484243..484509 (+) | 267 | WP_003689070.1 | hypothetical protein | - |
| G4V52_RS02595 | - | 484509..485108 (+) | 600 | WP_003692874.1 | DUF2460 domain-containing protein | - |
| G4V52_RS02600 | - | 485105..485959 (+) | 855 | WP_003689066.1 | DUF2163 domain-containing protein | - |
| G4V52_RS02605 | - | 485961..486392 (+) | 432 | WP_003689064.1 | NlpC/P60 family protein | - |
| G4V52_RS02610 | - | 486420..486698 (-) | 279 | WP_003692877.1 | XRE family transcriptional regulator | - |
| G4V52_RS02615 | - | 486938..491083 (+) | 4146 | WP_203029635.1 | phage tail protein | - |
| G4V52_RS02620 | - | 491195..491500 (+) | 306 | WP_003689058.1 | hypothetical protein | - |
| G4V52_RS02625 | - | 491571..492041 (+) | 471 | WP_003691410.1 | hypothetical protein | - |
| G4V52_RS02630 | - | 492042..492374 (+) | 333 | WP_003691408.1 | hypothetical protein | - |
| G4V52_RS02635 | - | 492504..492737 (-) | 234 | WP_003692884.1 | hypothetical protein | - |
| G4V52_RS02640 | - | 492745..493092 (-) | 348 | WP_003689051.1 | type II toxin-antitoxin system PemK/MazF family toxin | - |
| G4V52_RS02645 | - | 493092..493328 (-) | 237 | WP_003689049.1 | AbrB/MazE/SpoVT family DNA-binding domain-containing protein | - |
| G4V52_RS12390 | - | 493368..493493 (+) | 126 | WP_255294325.1 | hypothetical protein | - |
| G4V52_RS02650 | - | 493535..494074 (+) | 540 | WP_064661616.1 | TIGR02594 family protein | - |
| G4V52_RS02655 | - | 494075..494419 (+) | 345 | WP_003695464.1 | hypothetical protein | - |
| G4V52_RS02660 | - | 494403..494576 (+) | 174 | WP_017146757.1 | hypothetical protein | - |
| G4V52_RS02665 | - | 495067..498111 (+) | 3045 | WP_203029636.1 | tape measure protein | - |
| G4V52_RS02670 | - | 498171..498650 (-) | 480 | WP_002241413.1 | DUF4760 domain-containing protein | - |
| G4V52_RS02675 | - | 498992..499981 (-) | 990 | WP_003689040.1 | site-specific integrase | - |
| G4V52_RS02680 | - | 500241..500429 (-) | 189 | WP_003689039.1 | hypothetical protein | - |
| G4V52_RS02685 | purM | 500670..501704 (+) | 1035 | WP_003692893.1 | phosphoribosylformylglycinamidine cyclo-ligase | - |
| G4V52_RS02695 | - | 502702..503355 (+) | 654 | WP_050388908.1 | IS1595 family transposase | - |
| G4V52_RS02700 | - | 503489..505516 (+) | 2028 | WP_003692895.1 | BCCT family transporter | - |
| G4V52_RS02705 | - | 505606..507159 (-) | 1554 | WP_048654402.1 | fatty acid--CoA ligase | - |
| G4V52_RS12395 | - | 507210..507338 (+) | 129 | WP_255294324.1 | hypothetical protein | - |
| G4V52_RS02710 | - | 507410..508603 (-) | 1194 | WP_003700045.1 | SGNH/GDSL hydrolase family protein | - |
Sequence
Protein
Download Length: 203 a.a. Molecular weight: 22153.94 Da Isoelectric Point: 5.3780
>NTDB_id=423993 G4V52_RS02330 WP_003687918.1 450295..450906(+) (pilK) [Neisseria gonorrhoeae strain SRRSH205]
MRKQNTLTGIPTSDGQRGSALFIVLMVMIVVAFLVVTAAQSYNTEQRISANESDRKLALSLAEAALREGEFQVLDLEYTA
DSKVTFSENCEKGLCTAVNVRTNNNGNEEVFGNIVVQGTPTVEAVKRSCPAKSGKNSTGLCIDNQGVEYEKGTGNVSKMP
RYIIEYLGEKNNQNIYRVTAKAWGKNANTVVVLQSYVGNNDEQ
MRKQNTLTGIPTSDGQRGSALFIVLMVMIVVAFLVVTAAQSYNTEQRISANESDRKLALSLAEAALREGEFQVLDLEYTA
DSKVTFSENCEKGLCTAVNVRTNNNGNEEVFGNIVVQGTPTVEAVKRSCPAKSGKNSTGLCIDNQGVEYEKGTGNVSKMP
RYIIEYLGEKNNQNIYRVTAKAWGKNANTVVVLQSYVGNNDEQ
Nucleotide
Download Length: 612 bp
>NTDB_id=423993 G4V52_RS02330 WP_003687918.1 450295..450906(+) (pilK) [Neisseria gonorrhoeae strain SRRSH205]
ATGCGCAAACAGAACACTTTGACAGGAATCCCGACTTCTGACGGACAGAGGGGGTCCGCACTGTTTATCGTGCTGATGGT
GATGATAGTCGTGGCCTTTTTGGTTGTAACTGCCGCCCAGTCCTACAATACCGAACAGAGGATCAGTGCCAACGAATCAG
ACAGGAAATTGGCTTTGTCTTTAGCCGAGGCGGCTTTGAGGGAAGGCGAATTTCAGGTTTTGGATTTGGAATATACTGCG
GATAGTAAGGTTACATTTAGCGAAAACTGTGAAAAAGGCCTGTGTACCGCAGTGAATGTGCGGACAAATAATAATGGTAA
TGAAGAGGTTTTTGGCAATATCGTGGTGCAAGGCACGCCCACCGTTGAGGCGGTGAAGCGTTCTTGCCCTGCAAAGTCTG
GCAAAAATTCTACCGGCCTGTGCATTGACAATCAGGGAGTGGAATATGAGAAAGGTACGGGAAACGTCAGCAAAATGCCG
CGTTATATTATCGAATATTTGGGCGAGAAGAATAACCAAAATATTTACAGGGTTACTGCCAAGGCTTGGGGTAAGAATGC
CAATACCGTGGTCGTCCTGCAATCTTATGTAGGCAATAATGATGAGCAATAA
ATGCGCAAACAGAACACTTTGACAGGAATCCCGACTTCTGACGGACAGAGGGGGTCCGCACTGTTTATCGTGCTGATGGT
GATGATAGTCGTGGCCTTTTTGGTTGTAACTGCCGCCCAGTCCTACAATACCGAACAGAGGATCAGTGCCAACGAATCAG
ACAGGAAATTGGCTTTGTCTTTAGCCGAGGCGGCTTTGAGGGAAGGCGAATTTCAGGTTTTGGATTTGGAATATACTGCG
GATAGTAAGGTTACATTTAGCGAAAACTGTGAAAAAGGCCTGTGTACCGCAGTGAATGTGCGGACAAATAATAATGGTAA
TGAAGAGGTTTTTGGCAATATCGTGGTGCAAGGCACGCCCACCGTTGAGGCGGTGAAGCGTTCTTGCCCTGCAAAGTCTG
GCAAAAATTCTACCGGCCTGTGCATTGACAATCAGGGAGTGGAATATGAGAAAGGTACGGGAAACGTCAGCAAAATGCCG
CGTTATATTATCGAATATTTGGGCGAGAAGAATAACCAAAATATTTACAGGGTTACTGCCAAGGCTTGGGGTAAGAATGC
CAATACCGTGGTCGTCCTGCAATCTTATGTAGGCAATAATGATGAGCAATAA
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| pilK | Neisseria gonorrhoeae MS11 |
100 |
100 |
1 |