Detailed information    

insolico Bioinformatically predicted

Overview

Name   sinI   Type   Regulator
Locus tag   G4P54_RS12920 Genome accession   NZ_CP048852
Coordinates   2425398..2425571 (+) Length   57 a.a.
NCBI ID   WP_024715075.1    Uniprot ID   A0A6H0WJA8
Organism   Bacillus tequilensis strain EA-CB0015     
Function   inhibit the expression of sinR (predicted from homology)   
Competence regulation

Genomic Context

Location: 2420398..2430571
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  G4P54_RS12905 (G4P54_12860) gcvT 2421196..2422284 (-) 1089 WP_167872863.1 glycine cleavage system aminomethyltransferase GcvT -
  G4P54_RS12910 (G4P54_12865) - 2422725..2424398 (+) 1674 WP_167872864.1 DEAD/DEAH box helicase -
  G4P54_RS12915 (G4P54_12870) - 2424419..2425213 (+) 795 WP_167872865.1 YqhG family protein -
  G4P54_RS12920 (G4P54_12875) sinI 2425398..2425571 (+) 174 WP_024715075.1 anti-repressor SinI Regulator
  G4P54_RS12925 (G4P54_12880) sinR 2425605..2425940 (+) 336 WP_024715074.1 transcriptional regulator SinR Regulator
  G4P54_RS12930 (G4P54_12885) tasA 2426035..2426820 (-) 786 WP_024715073.1 biofilm matrix protein TasA -
  G4P54_RS12935 (G4P54_12890) sipW 2426885..2427457 (-) 573 WP_167873877.1 signal peptidase I SipW -
  G4P54_RS12940 (G4P54_12895) tapA 2427441..2428202 (-) 762 WP_167872866.1 amyloid fiber anchoring/assembly protein TapA -
  G4P54_RS12945 (G4P54_12900) - 2428471..2428797 (+) 327 WP_167872867.1 YqzG/YhdC family protein -
  G4P54_RS12950 (G4P54_12905) - 2428839..2429018 (-) 180 WP_024715069.1 YqzE family protein -
  G4P54_RS12955 (G4P54_12910) comGG 2429090..2429464 (-) 375 WP_167872868.1 competence type IV pilus minor pilin ComGG Machinery gene
  G4P54_RS12960 (G4P54_12915) comGF 2429465..2429848 (-) 384 WP_167873878.1 competence type IV pilus minor pilin ComGF Machinery gene
  G4P54_RS12965 (G4P54_12920) comGE 2429874..2430221 (-) 348 WP_167872869.1 competence type IV pilus minor pilin ComGE Machinery gene

Sequence

Protein


Download         Length: 57 a.a.        Molecular weight: 6630.60 Da        Isoelectric Point: 8.6596

>NTDB_id=423565 G4P54_RS12920 WP_024715075.1 2425398..2425571(+) (sinI) [Bacillus tequilensis strain EA-CB0015]
MKNAKQEHFELDQEWVELMLKAKEANISPEEIRKYLLLNKKSSHPGPAARSHTVNPF

Nucleotide


Download         Length: 174 bp        

>NTDB_id=423565 G4P54_RS12920 WP_024715075.1 2425398..2425571(+) (sinI) [Bacillus tequilensis strain EA-CB0015]
ATGAAAAATGCAAAACAAGAGCACTTCGAATTAGATCAAGAATGGGTTGAATTAATGCTGAAAGCCAAAGAGGCAAATAT
CAGCCCTGAAGAAATACGAAAATATTTACTTTTAAACAAAAAGTCTTCTCATCCTGGTCCGGCAGCTAGAAGTCATACCG
TAAATCCTTTCTGA

Domains

Predicted by InterproScan.

Anti-repressor SinI (SinI)

(11-36)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB A0A6H0WJA8

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sinI Bacillus subtilis subsp. subtilis str. 168

94.737

100

0.947