Detailed information    

insolico Bioinformatically predicted

Overview


Name   comGF   Type   Machinery gene
Locus tag   G4P54_RS12960 Genome accession   NZ_CP048852
Coordinates   2429465..2429848 (-) Length   127 a.a.
NCBI ID   WP_167873878.1    Uniprot ID   A0A6H0WQJ0
Organism   Bacillus tequilensis strain EA-CB0015     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 2424465..2434848
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  G4P54_RS12920 (G4P54_12875) sinI 2425398..2425571 (+) 174 WP_024715075.1 anti-repressor SinI Regulator
  G4P54_RS12925 (G4P54_12880) sinR 2425605..2425940 (+) 336 WP_024715074.1 transcriptional regulator SinR Regulator
  G4P54_RS12930 (G4P54_12885) tasA 2426035..2426820 (-) 786 WP_024715073.1 biofilm matrix protein TasA -
  G4P54_RS12935 (G4P54_12890) sipW 2426885..2427457 (-) 573 WP_167873877.1 signal peptidase I SipW -
  G4P54_RS12940 (G4P54_12895) tapA 2427441..2428202 (-) 762 WP_167872866.1 amyloid fiber anchoring/assembly protein TapA -
  G4P54_RS12945 (G4P54_12900) - 2428471..2428797 (+) 327 WP_167872867.1 YqzG/YhdC family protein -
  G4P54_RS12950 (G4P54_12905) - 2428839..2429018 (-) 180 WP_024715069.1 YqzE family protein -
  G4P54_RS12955 (G4P54_12910) comGG 2429090..2429464 (-) 375 WP_167872868.1 competence type IV pilus minor pilin ComGG Machinery gene
  G4P54_RS12960 (G4P54_12915) comGF 2429465..2429848 (-) 384 WP_167873878.1 competence type IV pilus minor pilin ComGF Machinery gene
  G4P54_RS12965 (G4P54_12920) comGE 2429874..2430221 (-) 348 WP_167872869.1 competence type IV pilus minor pilin ComGE Machinery gene
  G4P54_RS12970 (G4P54_12925) comGD 2430205..2430636 (-) 432 WP_167872870.1 competence type IV pilus minor pilin ComGD Machinery gene
  G4P54_RS12975 (G4P54_12930) comGC 2430626..2430922 (-) 297 WP_024715064.1 comG operon protein ComGC Machinery gene
  G4P54_RS12980 (G4P54_12935) comGB 2430936..2431973 (-) 1038 WP_167872871.1 competence type IV pilus assembly protein ComGB Machinery gene
  G4P54_RS12985 (G4P54_12940) comGA 2431960..2433030 (-) 1071 WP_167872872.1 competence protein ComGA Machinery gene
  G4P54_RS12990 (G4P54_12945) - 2433231..2433437 (-) 207 WP_240939667.1 hypothetical protein -
  G4P54_RS12995 (G4P54_12950) corA 2433641..2434594 (-) 954 WP_024715061.1 magnesium transporter CorA -

Sequence


Protein


Download         Length: 127 a.a.        Molecular weight: 14389.51 Da        Isoelectric Point: 6.4835

>NTDB_id=423568 G4P54_RS12960 WP_167873878.1 2429465..2429848(-) (comGF) [Bacillus tequilensis strain EA-CB0015]
MLISGSLAAIFQLFLSRQQEHDGFTQQEWMISMEQMMNECKQSHAVKTAEHGSVLICTNLSGQDIRFETYHSMIRKRVDG
KGHVPILDHITAMRADIENGVVLLNIKSENEKMYQTAFPVYPYLGGG

Nucleotide


Download         Length: 384 bp        

>NTDB_id=423568 G4P54_RS12960 WP_167873878.1 2429465..2429848(-) (comGF) [Bacillus tequilensis strain EA-CB0015]
TTGCTCATATCAGGTTCGTTAGCTGCTATCTTTCAGCTGTTTTTGTCACGACAGCAGGAACATGACGGTTTCACACAGCA
AGAATGGATGATATCGATGGAACAGATGATGAATGAGTGCAAGCAGTCACACGCTGTTAAGACAGCCGAGCATGGGAGCG
TGCTGATCTGCACCAATCTGTCCGGCCAAGATATCCGTTTTGAAACCTATCATTCCATGATAAGAAAAAGGGTAGATGGT
AAAGGGCATGTTCCGATTCTAGATCATATTACAGCCATGAGAGCTGATATTGAAAATGGGGTTGTTTTGCTCAACATTAA
GAGTGAGAACGAAAAAATGTATCAAACTGCTTTTCCGGTTTACCCGTATTTAGGAGGAGGATAA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB A0A6H0WQJ0

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGF Bacillus subtilis subsp. subtilis str. 168

88.976

100

0.89