Detailed information
Overview
| Name | degQ | Type | Regulator |
| Locus tag | BAMOH1_RS14630 | Genome accession | NZ_CP061853 |
| Coordinates | 3018346..3018486 (-) | Length | 46 a.a. |
| NCBI ID | WP_003152043.1 | Uniprot ID | A3KLB4 |
| Organism | Bacillus amyloliquefaciens strain MOH1-5b | ||
| Function | modification of regulators (predicted from homology) Competence regulation |
||
Genomic Context
Location: 3013346..3023486
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| BAMOH1_RS14605 (BAMOH1_14605) | - | 3013665..3014048 (-) | 384 | WP_014418761.1 | hotdog fold thioesterase | - |
| BAMOH1_RS14610 (BAMOH1_14610) | comA | 3014070..3014714 (-) | 645 | WP_014418762.1 | response regulator transcription factor | Regulator |
| BAMOH1_RS14615 (BAMOH1_14615) | comP | 3014795..3017101 (-) | 2307 | WP_191389162.1 | sensor histidine kinase | Regulator |
| BAMOH1_RS14620 (BAMOH1_14620) | comX | 3017124..3017300 (-) | 177 | WP_095273329.1 | competence pheromone ComX | - |
| BAMOH1_RS14625 (BAMOH1_14625) | comQ | 3017319..3018194 (-) | 876 | WP_095273351.1 | polyprenyl synthetase family protein | Regulator |
| BAMOH1_RS14630 (BAMOH1_14630) | degQ | 3018346..3018486 (-) | 141 | WP_003152043.1 | degradation enzyme regulation protein DegQ | Regulator |
| BAMOH1_RS14635 (BAMOH1_14635) | - | 3018951..3019292 (+) | 342 | WP_021495366.1 | hypothetical protein | - |
| BAMOH1_RS14640 (BAMOH1_14640) | - | 3019299..3020522 (-) | 1224 | WP_007613436.1 | EAL and HDOD domain-containing protein | - |
| BAMOH1_RS14645 (BAMOH1_14645) | - | 3020652..3022118 (-) | 1467 | WP_014418767.1 | nicotinate phosphoribosyltransferase | - |
| BAMOH1_RS14650 (BAMOH1_14650) | - | 3022136..3022687 (-) | 552 | WP_003152033.1 | cysteine hydrolase family protein | - |
| BAMOH1_RS14655 (BAMOH1_14655) | - | 3022784..3023182 (-) | 399 | WP_003152031.1 | YueI family protein | - |
Sequence
Protein
Download Length: 46 a.a. Molecular weight: 5518.30 Da Isoelectric Point: 4.9432
>NTDB_id=423384 BAMOH1_RS14630 WP_003152043.1 3018346..3018486(-) (degQ) [Bacillus amyloliquefaciens strain MOH1-5b]
MENKLEEVKQLLFRLENDIRETTDSLRNINKSIDQLDKFSYAMKIS
MENKLEEVKQLLFRLENDIRETTDSLRNINKSIDQLDKFSYAMKIS
Nucleotide
Download Length: 141 bp
>NTDB_id=423384 BAMOH1_RS14630 WP_003152043.1 3018346..3018486(-) (degQ) [Bacillus amyloliquefaciens strain MOH1-5b]
GTGGAAAACAAATTAGAAGAAGTAAAGCAATTATTATTCCGACTTGAAAATGATATCAGAGAAACAACCGACTCATTACG
AAACATTAACAAAAGCATTGATCAGCTCGATAAATTCTCATATGCAATGAAAATTTCTTAA
GTGGAAAACAAATTAGAAGAAGTAAAGCAATTATTATTCCGACTTGAAAATGATATCAGAGAAACAACCGACTCATTACG
AAACATTAACAAAAGCATTGATCAGCTCGATAAATTCTCATATGCAATGAAAATTTCTTAA
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| degQ | Bacillus subtilis subsp. subtilis str. 168 |
89.13 |
100 |
0.891 |