Detailed information    

insolico Bioinformatically predicted

Overview


Name   sinI   Type   Regulator
Locus tag   M654_RS15770 Genome accession   NZ_CP048273
Coordinates   3027288..3027464 (+) Length   58 a.a.
NCBI ID   WP_026587842.1    Uniprot ID   A0A6I7FAJ8
Organism   Bacillus sp. NSP9.1     
Function   inhibit the expression of sinR (predicted from homology)   
Competence regulation

Genomic Context


Location: 3022288..3032464
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  M654_RS15755 (M654_015705) gcvT 3022947..3024041 (-) 1095 WP_026587839.1 glycine cleavage system aminomethyltransferase GcvT -
  M654_RS15760 (M654_015710) - 3024625..3026304 (+) 1680 WP_026587840.1 SNF2-related protein -
  M654_RS15765 (M654_015715) - 3026308..3027102 (+) 795 WP_026587841.1 YqhG family protein -
  M654_RS15770 (M654_015720) sinI 3027288..3027464 (+) 177 WP_026587842.1 anti-repressor SinI family protein Regulator
  M654_RS15775 (M654_015725) sinR 3027498..3027833 (+) 336 WP_006637528.1 helix-turn-helix domain-containing protein Regulator
  M654_RS15780 (M654_015730) - 3027943..3028737 (-) 795 WP_026587843.1 TasA family protein -
  M654_RS15785 (M654_015735) - 3028806..3029390 (-) 585 WP_026587844.1 signal peptidase I -
  M654_RS15790 (M654_015740) tapA 3029387..3030115 (-) 729 WP_026587845.1 amyloid fiber anchoring/assembly protein TapA -
  M654_RS15795 (M654_015745) - 3030385..3030702 (+) 318 WP_026587846.1 YqzG/YhdC family protein -
  M654_RS15800 (M654_015750) - 3030789..3030974 (-) 186 WP_026587847.1 YqzE family protein -
  M654_RS15805 (M654_015755) comGG 3031046..3031411 (-) 366 WP_026587848.1 competence type IV pilus minor pilin ComGG -
  M654_RS24145 (M654_015760) comGF 3031425..3031913 (-) 489 WP_077736493.1 competence type IV pilus minor pilin ComGF -
  M654_RS15815 (M654_015765) comGE 3031822..3032169 (-) 348 WP_026587850.1 competence type IV pilus minor pilin ComGE -

Sequence


Protein


Download         Length: 58 a.a.        Molecular weight: 6765.57 Da        Isoelectric Point: 5.1069

>NTDB_id=420459 M654_RS15770 WP_026587842.1 3027288..3027464(+) (sinI) [Bacillus sp. NSP9.1]
MNKDKNEKEEWDEEWAELIKNALKAGISPEEIRFFLRLGKKSSEASTSIERSHSINPF

Nucleotide


Download         Length: 177 bp        

>NTDB_id=420459 M654_RS15770 WP_026587842.1 3027288..3027464(+) (sinI) [Bacillus sp. NSP9.1]
ATGAATAAAGATAAAAATGAGAAAGAAGAATGGGATGAGGAATGGGCAGAGCTGATCAAAAATGCCCTGAAAGCAGGCAT
TAGTCCAGAAGAAATACGGTTTTTTCTTCGTTTAGGAAAGAAGTCTTCCGAAGCTTCCACATCAATTGAAAGAAGTCATT
CAATAAATCCTTTCTGA

Domains


Predicted by InterProScan.

(12-37)


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sinI Bacillus subtilis subsp. subtilis str. 168

50

100

0.5


Multiple sequence alignment