Detailed information
Overview
| Name | comGG | Type | Machinery gene |
| Locus tag | GV831_RS10825 | Genome accession | NZ_CP047891 |
| Coordinates | 2176650..2176934 (+) | Length | 94 a.a. |
| NCBI ID | WP_003129993.1 | Uniprot ID | - |
| Organism | Lactococcus lactis subsp. lactis strain WHH2311 | ||
| Function | dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology) DNA binding and uptake |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 2138793..2177461 | 2176650..2176934 | within | 0 |
Gene organization within MGE regions
Location: 2138793..2177461
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| GV831_RS10545 (GV831_10505) | - | 2139826..2139966 (+) | 141 | WP_228777719.1 | hypothetical protein | - |
| GV831_RS10550 (GV831_10510) | - | 2139963..2141420 (-) | 1458 | WP_014570823.1 | recombinase family protein | - |
| GV831_RS10555 (GV831_10515) | - | 2141546..2142085 (-) | 540 | WP_014570822.1 | PH domain-containing protein | - |
| GV831_RS10560 (GV831_10520) | - | 2142141..2142725 (-) | 585 | WP_014570821.1 | hypothetical protein | - |
| GV831_RS10565 (GV831_10525) | - | 2142736..2143146 (-) | 411 | WP_014570820.1 | helix-turn-helix domain-containing protein | - |
| GV831_RS10570 (GV831_10530) | - | 2143323..2143556 (+) | 234 | WP_014570819.1 | helix-turn-helix transcriptional regulator | - |
| GV831_RS10575 (GV831_10535) | - | 2143615..2144304 (+) | 690 | WP_014570818.1 | phage regulatory protein | - |
| GV831_RS10580 (GV831_10540) | - | 2144320..2144502 (+) | 183 | WP_043991177.1 | hypothetical protein | - |
| GV831_RS10585 | - | 2144499..2144621 (+) | 123 | WP_014570816.1 | hypothetical protein | - |
| GV831_RS10590 (GV831_10545) | - | 2144635..2144883 (+) | 249 | WP_014570815.1 | hypothetical protein | - |
| GV831_RS10595 (GV831_10550) | - | 2144986..2145819 (+) | 834 | WP_014570814.1 | hypothetical protein | - |
| GV831_RS10600 (GV831_10555) | - | 2145816..2146742 (+) | 927 | WP_014570813.1 | RecT family recombinase | - |
| GV831_RS10605 (GV831_10560) | - | 2147006..2147920 (+) | 915 | WP_014570812.1 | phage replisome organizer N-terminal domain-containing protein | - |
| GV831_RS10610 (GV831_10565) | - | 2147913..2148155 (+) | 243 | WP_014570811.1 | L-rhamnose isomerase | - |
| GV831_RS10615 (GV831_10570) | - | 2148168..2148578 (+) | 411 | WP_014570810.1 | hypothetical protein | - |
| GV831_RS10620 (GV831_10575) | - | 2148901..2149176 (+) | 276 | WP_014570536.1 | hypothetical protein | - |
| GV831_RS10625 (GV831_10580) | - | 2149188..2149577 (+) | 390 | WP_014570537.1 | hypothetical protein | - |
| GV831_RS10630 (GV831_10585) | - | 2149719..2150393 (+) | 675 | WP_014570539.1 | DUF1642 domain-containing protein | - |
| GV831_RS10635 (GV831_10590) | - | 2150390..2150809 (+) | 420 | WP_003129863.1 | dUTP diphosphatase | - |
| GV831_RS10640 (GV831_10595) | - | 2150813..2151157 (+) | 345 | WP_198493811.1 | hypothetical protein | - |
| GV831_RS10645 (GV831_10600) | - | 2151154..2151405 (+) | 252 | WP_014570807.1 | hypothetical protein | - |
| GV831_RS10650 (GV831_10605) | - | 2151428..2151589 (+) | 162 | WP_181407342.1 | hypothetical protein | - |
| GV831_RS10655 (GV831_10610) | - | 2151582..2151953 (+) | 372 | WP_014570805.1 | hypothetical protein | - |
| GV831_RS10660 (GV831_10615) | - | 2151956..2152279 (+) | 324 | WP_014570804.1 | DUF1140 family protein | - |
| GV831_RS10665 (GV831_10620) | - | 2152340..2152558 (+) | 219 | WP_014570803.1 | hypothetical protein | - |
| GV831_RS10670 (GV831_10625) | - | 2152555..2152749 (+) | 195 | WP_023349206.1 | DUF1660 domain-containing protein | - |
| GV831_RS10675 | - | 2152878..2153039 (+) | 162 | WP_003131301.1 | hypothetical protein | - |
| GV831_RS10680 (GV831_10630) | - | 2153117..2153539 (+) | 423 | WP_014570802.1 | RinA family protein | - |
| GV831_RS10690 (GV831_10640) | - | 2154016..2155173 (+) | 1158 | Protein_2064 | DNA modification methylase | - |
| GV831_RS10695 (GV831_10645) | - | 2155202..2155699 (+) | 498 | WP_014570801.1 | hypothetical protein | - |
| GV831_RS10700 (GV831_10650) | terL | 2155680..2157131 (+) | 1452 | WP_014570551.1 | phage terminase large subunit | - |
| GV831_RS10705 (GV831_10655) | - | 2157144..2158673 (+) | 1530 | WP_014570552.1 | phage portal protein | - |
| GV831_RS10710 (GV831_10660) | - | 2158666..2159496 (+) | 831 | WP_014570553.1 | phage minor head protein | - |
| GV831_RS10715 (GV831_10665) | - | 2159512..2160576 (+) | 1065 | WP_124156149.1 | XkdF-like putative serine protease domain-containing protein | - |
| GV831_RS10720 (GV831_10670) | - | 2160591..2161508 (+) | 918 | WP_003131315.1 | hypothetical protein | - |
| GV831_RS10725 (GV831_10675) | - | 2161537..2161773 (+) | 237 | WP_014570555.1 | Ig-like domain-containing protein | - |
| GV831_RS10730 (GV831_10680) | - | 2161847..2162248 (+) | 402 | WP_014570556.1 | hypothetical protein | - |
| GV831_RS10735 (GV831_10685) | - | 2162238..2162582 (+) | 345 | WP_014570557.1 | putative minor capsid protein | - |
| GV831_RS10740 (GV831_10690) | - | 2162579..2162908 (+) | 330 | WP_003131320.1 | hypothetical protein | - |
| GV831_RS10745 (GV831_10695) | - | 2162908..2163342 (+) | 435 | WP_014570558.1 | minor capsid protein | - |
| GV831_RS10750 (GV831_10700) | - | 2163353..2163829 (+) | 477 | WP_014570559.1 | phage tail tube protein | - |
| GV831_RS10755 (GV831_10705) | - | 2163886..2164293 (+) | 408 | WP_003131323.1 | hypothetical protein | - |
| GV831_RS10760 (GV831_10710) | - | 2164309..2165016 (+) | 708 | WP_014570560.1 | Gp15 family bacteriophage protein | - |
| GV831_RS10765 (GV831_10715) | - | 2165006..2167219 (+) | 2214 | WP_014570561.1 | phage tail tape measure protein | - |
| GV831_RS10770 (GV831_10720) | - | 2167229..2168758 (+) | 1530 | WP_014570562.1 | distal tail protein Dit | - |
| GV831_RS10775 (GV831_10725) | - | 2168737..2172822 (+) | 4086 | WP_193363677.1 | hypothetical protein | - |
| GV831_RS10780 (GV831_10730) | - | 2172834..2173070 (+) | 237 | WP_014570799.1 | hypothetical protein | - |
| GV831_RS10785 (GV831_10735) | - | 2173083..2173433 (+) | 351 | WP_014570798.1 | hypothetical protein | - |
| GV831_RS10790 (GV831_10740) | - | 2173446..2173745 (+) | 300 | WP_014570797.1 | phage holin | - |
| GV831_RS10795 (GV831_10745) | - | 2173745..2174524 (+) | 780 | WP_014570796.1 | peptidoglycan amidohydrolase family protein | - |
| GV831_RS10800 (GV831_10750) | - | 2174603..2175127 (+) | 525 | WP_014570795.1 | GNAT family N-acetyltransferase | - |
| GV831_RS10805 (GV831_10755) | comGC | 2175274..2175543 (+) | 270 | WP_003129998.1 | competence type IV pilus major pilin ComGC | Machinery gene |
| GV831_RS10810 (GV831_10760) | comGD | 2175503..2175934 (+) | 432 | WP_014570794.1 | competence type IV pilus minor pilin ComGD | Machinery gene |
| GV831_RS10815 (GV831_10765) | comGE | 2175906..2176202 (+) | 297 | WP_010906316.1 | competence type IV pilus minor pilin ComGE | Machinery gene |
| GV831_RS10820 (GV831_10770) | comGF | 2176165..2176611 (+) | 447 | WP_029344525.1 | competence type IV pilus minor pilin ComGF | Machinery gene |
| GV831_RS10825 (GV831_10775) | comGG | 2176650..2176934 (+) | 285 | WP_003129993.1 | competence type IV pilus minor pilin ComGG | Machinery gene |
| GV831_RS10830 (GV831_10780) | - | 2177024..2177461 (+) | 438 | WP_003129992.1 | zinc-dependent MarR family transcriptional regulator | - |
Sequence
Protein
Download Length: 94 a.a. Molecular weight: 10783.02 Da Isoelectric Point: 5.0604
>NTDB_id=418359 GV831_RS10825 WP_003129993.1 2176650..2176934(+) (comGG) [Lactococcus lactis subsp. lactis strain WHH2311]
MFSMFLQFYLERQIDDARQLRSEKEQLTAELMVSVALKTDLKSQGQIHFDSGDLSYNLLTDSSASSKITDHSSDENTYQF
SIHLKDGANFQIKK
MFSMFLQFYLERQIDDARQLRSEKEQLTAELMVSVALKTDLKSQGQIHFDSGDLSYNLLTDSSASSKITDHSSDENTYQF
SIHLKDGANFQIKK
Nucleotide
Download Length: 285 bp
>NTDB_id=418359 GV831_RS10825 WP_003129993.1 2176650..2176934(+) (comGG) [Lactococcus lactis subsp. lactis strain WHH2311]
ATGTTTTCAATGTTTCTTCAGTTCTATTTGGAAAGGCAAATAGATGATGCTCGACAATTAAGAAGTGAAAAGGAGCAGTT
AACAGCTGAATTAATGGTGTCAGTAGCTTTAAAGACTGATTTAAAATCTCAAGGTCAAATTCATTTTGATTCAGGAGATT
TGTCCTACAATTTACTGACAGATTCGTCAGCCAGTTCAAAAATTACTGACCATTCAAGTGATGAAAATACCTATCAATTT
AGTATCCATCTAAAAGATGGCGCAAACTTTCAAATAAAAAAATAA
ATGTTTTCAATGTTTCTTCAGTTCTATTTGGAAAGGCAAATAGATGATGCTCGACAATTAAGAAGTGAAAAGGAGCAGTT
AACAGCTGAATTAATGGTGTCAGTAGCTTTAAAGACTGATTTAAAATCTCAAGGTCAAATTCATTTTGATTCAGGAGATT
TGTCCTACAATTTACTGACAGATTCGTCAGCCAGTTCAAAAATTACTGACCATTCAAGTGATGAAAATACCTATCAATTT
AGTATCCATCTAAAAGATGGCGCAAACTTTCAAATAAAAAAATAA
Domains
No domain identified.
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| comGG | Lactococcus lactis subsp. cremoris KW2 |
58.511 |
100 |
0.585 |