Detailed information    

insolico Bioinformatically predicted

Overview


Name   comK/comK1   Type   Regulator
Locus tag   E3S80_RS05660 Genome accession   NZ_CP047847
Coordinates   1087892..1088461 (+) Length   189 a.a.
NCBI ID   WP_000287265.1    Uniprot ID   A0A7U7EXU5
Organism   Staphylococcus aureus strain UP_522     
Function   promote expression of competence genes (predicted from homology)   
Competence regulation

Related MGE


Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
ICE 1051850..1087790 1087892..1088461 flank 102


Gene organization within MGE regions


Location: 1051850..1088461
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  E3S80_RS05435 (E3S80_05435) - 1052540..1053694 (+) 1155 WP_000777579.1 aminotransferase class I/II-fold pyridoxal phosphate-dependent enzyme -
  E3S80_RS05440 (E3S80_05440) sspA 1054222..1055232 (+) 1011 WP_031775067.1 Glu-specific serine endopeptidase SspA -
  E3S80_RS05445 (E3S80_05445) sspB 1055314..1056495 (+) 1182 WP_001089097.1 cysteine protease staphopain B -
  E3S80_RS05450 (E3S80_05450) sspC 1056533..1056862 (+) 330 WP_000284457.1 staphostatin B -
  E3S80_RS05455 (E3S80_05455) menB 1057100..1057921 (-) 822 WP_000184947.1 1,4-dihydroxy-2-naphthoyl-CoA synthase -
  E3S80_RS05460 (E3S80_05460) menH 1057914..1058717 (-) 804 WP_000150199.1 2-succinyl-6-hydroxy-2, 4-cyclohexadiene-1-carboxylate synthase -
  E3S80_RS05465 (E3S80_05465) menD 1058704..1060377 (-) 1674 WP_000526680.1 2-succinyl-5-enolpyruvyl-6-hydroxy-3- cyclohexene-1-carboxylic-acid synthase -
  E3S80_RS05470 (E3S80_05470) - 1060364..1061698 (-) 1335 WP_223876854.1 isochorismate synthase -
  E3S80_RS14205 (E3S80_05475) - 1061652..1061756 (-) 105 WP_001791731.1 hypothetical protein -
  E3S80_RS05480 (E3S80_05480) - 1061907..1062845 (+) 939 WP_000070966.1 1,4-dihydroxy-2-naphthoate polyprenyltransferase -
  E3S80_RS05485 (E3S80_05485) - 1062897..1063448 (-) 552 WP_000620949.1 GNAT family N-acetyltransferase -
  E3S80_RS05490 (E3S80_05490) - 1063613..1063828 (+) 216 WP_000867357.1 TM2 domain-containing protein -
  E3S80_RS05495 (E3S80_05495) - 1063892..1064023 (+) 132 WP_001790177.1 SAR1012 family small protein -
  E3S80_RS05500 (E3S80_05500) - 1064069..1065029 (-) 961 Protein_1065 ABC transporter substrate-binding protein -
  E3S80_RS05505 (E3S80_05505) - 1065517..1065873 (+) 357 WP_000766009.1 DoxX family protein -
  E3S80_RS05510 (E3S80_05510) - 1065962..1066099 (-) 138 WP_001792054.1 poly(glycerol-phosphate) alpha-glucosyltransferase -
  E3S80_RS05515 (E3S80_05515) - 1066240..1066530 (+) 291 WP_001795266.1 hypothetical protein -
  E3S80_RS05520 (E3S80_05520) - 1066618..1067259 (-) 642 WP_000571167.1 ABC transporter ATP-binding protein -
  E3S80_RS05525 (E3S80_05525) - 1067256..1067576 (-) 321 WP_000668627.1 YxeA family protein -
  E3S80_RS05530 (E3S80_05530) - 1067579..1068322 (-) 744 Protein_1071 DUF1430 domain-containing protein -
  E3S80_RS05535 (E3S80_05535) - 1068542..1069078 (-) 537 WP_078056058.1 IS30 family transposase -
  E3S80_RS05540 (E3S80_05540) - 1069059..1069562 (-) 504 WP_160199374.1 helix-turn-helix domain-containing protein -
  E3S80_RS05545 (E3S80_05545) - 1069671..1070027 (-) 357 WP_001255379.1 cystatin-like fold lipoprotein -
  E3S80_RS05550 (E3S80_05550) - 1070083..1070673 (-) 591 WP_000810443.1 hypothetical protein -
  E3S80_RS05555 (E3S80_05555) - 1070680..1071726 (-) 1047 WP_160199375.1 CHAP domain-containing protein -
  E3S80_RS05560 (E3S80_05560) - 1071716..1073563 (-) 1848 WP_000681154.1 CD3337/EF1877 family mobilome membrane protein -
  E3S80_RS05565 (E3S80_05565) - 1073568..1074926 (-) 1359 WP_001251190.1 FtsK/SpoIIIE domain-containing protein -
  E3S80_RS05570 (E3S80_05570) - 1074989..1075255 (-) 267 WP_000453449.1 hypothetical protein -
  E3S80_RS05575 (E3S80_05575) - 1075493..1075969 (+) 477 WP_001031902.1 hypothetical protein -
  E3S80_RS05580 (E3S80_05580) - 1076142..1078637 (-) 2496 WP_001049261.1 ATP-binding protein -
  E3S80_RS05585 (E3S80_05585) - 1078672..1079055 (-) 384 WP_000358144.1 TcpE family conjugal transfer membrane protein -
  E3S80_RS05590 (E3S80_05590) - 1079067..1079327 (-) 261 WP_000015639.1 TcpD family membrane protein -
  E3S80_RS05595 (E3S80_05595) - 1079332..1080387 (-) 1056 WP_000692002.1 conjugal transfer protein -
  E3S80_RS05600 (E3S80_05600) - 1080448..1081539 (-) 1092 WP_000173102.1 replication initiation factor domain-containing protein -
  E3S80_RS05605 (E3S80_05605) - 1081714..1082016 (-) 303 WP_000386891.1 hypothetical protein -
  E3S80_RS05610 (E3S80_05610) - 1082030..1082350 (-) 321 WP_000805734.1 DUF961 family protein -
  E3S80_RS05615 (E3S80_05615) - 1082501..1082785 (-) 285 WP_000134542.1 hypothetical protein -
  E3S80_RS05620 (E3S80_05620) - 1082839..1084062 (-) 1224 Protein_1089 bacteriocin-associated integral membrane family protein -
  E3S80_RS05625 (E3S80_05625) - 1084106..1084378 (-) 273 WP_001797239.1 lactococcin 972 family bacteriocin -
  E3S80_RS05630 (E3S80_05630) - 1084388..1084489 (-) 102 WP_031763719.1 hypothetical protein -
  E3S80_RS14375 - 1085028..1085105 (-) 78 WP_099112139.1 putative holin-like toxin -
  E3S80_RS05640 (E3S80_05640) - 1085405..1086007 (-) 603 WP_001033865.1 type II CAAX prenyl endopeptidase Rce1 family protein -
  E3S80_RS05645 (E3S80_05645) - 1086022..1086198 (-) 177 WP_000214898.1 YkvS family protein -
  E3S80_RS05650 (E3S80_05650) - 1086397..1087383 (+) 987 WP_000668818.1 lipoate--protein ligase -
  E3S80_RS05655 (E3S80_05655) - 1087464..1087682 (-) 219 WP_000876826.1 IDEAL domain-containing protein -
  E3S80_RS05660 (E3S80_05660) comK/comK1 1087892..1088461 (+) 570 WP_000287265.1 competence protein ComK Regulator

Sequence


Protein


Download         Length: 189 a.a.        Molecular weight: 22601.83 Da        Isoelectric Point: 9.6091

>NTDB_id=417727 E3S80_RS05660 WP_000287265.1 1087892..1088461(+) (comK/comK1) [Staphylococcus aureus strain UP_522]
MYSQNIYVIRKGDMVIRPAFDDDDQRNGSEIIRFDKTRIQNPFKVQKIIERSCKFYGNTYLGKKAETNRITGISSKPPIL
LTPLFPTYFFPTHSDRQNENIWLNMHYIESIKELKNRKCKVTFINNESIILHVSYHSLWHQYNNSIFYYYMVDKQSRMIS
KNPDQPIDYNKATLNVFEALTRYSLFEDK

Nucleotide


Download         Length: 570 bp        

>NTDB_id=417727 E3S80_RS05660 WP_000287265.1 1087892..1088461(+) (comK/comK1) [Staphylococcus aureus strain UP_522]
ATGTATTCTCAAAATATTTATGTGATACGCAAAGGAGACATGGTTATTCGACCAGCATTTGATGATGACGATCAAAGAAA
CGGTAGTGAAATAATTCGGTTTGACAAAACGCGTATTCAAAATCCTTTTAAAGTCCAGAAAATCATTGAACGCTCTTGCA
AATTTTATGGTAATACTTATCTTGGCAAGAAAGCAGAGACAAACCGCATTACTGGCATTTCTAGTAAACCACCTATTTTA
CTAACACCATTATTTCCAACTTATTTTTTCCCAACACATTCTGACAGACAAAATGAAAATATTTGGTTAAATATGCATTA
TATCGAAAGTATTAAAGAATTAAAAAATCGTAAATGTAAAGTGACATTTATTAATAATGAATCTATCATTCTTCATGTTT
CATACCACAGTTTATGGCATCAATATAACAATTCCATTTTTTACTATTACATGGTAGATAAACAATCTCGCATGATATCA
AAAAATCCCGACCAACCAATAGATTATAATAAAGCCACATTGAATGTGTTTGAAGCATTGACACGCTATTCTTTATTTGA
AGATAAATAA

Domains


Predicted by InterproScan.

(5-156)


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB A0A7U7EXU5

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comK/comK1 Staphylococcus aureus MW2

100

100

1

  comK/comK1 Staphylococcus aureus N315

100

100

1


Multiple sequence alignment