Detailed information
Overview
| Name | degQ | Type | Regulator |
| Locus tag | GKS41_RS17420 | Genome accession | NZ_CP047268 |
| Coordinates | 3501188..3501328 (-) | Length | 46 a.a. |
| NCBI ID | WP_003152043.1 | Uniprot ID | A3KLB4 |
| Organism | Bacillus velezensis strain DH8043 | ||
| Function | modification of regulators (predicted from homology) Competence regulation |
||
Genomic Context
Location: 3496188..3506328
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| GKS41_RS17395 | - | 3496525..3496908 (-) | 384 | WP_014418761.1 | hotdog fold thioesterase | - |
| GKS41_RS17400 | comA | 3496930..3497574 (-) | 645 | WP_014418762.1 | response regulator transcription factor | Regulator |
| GKS41_RS17405 | comP | 3497655..3499949 (-) | 2295 | WP_159354531.1 | histidine kinase | Regulator |
| GKS41_RS17410 | comX | 3499961..3500125 (-) | 165 | WP_007613432.1 | competence pheromone ComX | - |
| GKS41_RS17415 | - | 3500125..3501036 (-) | 912 | WP_022553710.1 | polyprenyl synthetase family protein | - |
| GKS41_RS17420 | degQ | 3501188..3501328 (-) | 141 | WP_003152043.1 | degradation enzyme regulation protein DegQ | Regulator |
| GKS41_RS17425 | - | 3501793..3502134 (+) | 342 | WP_021495366.1 | hypothetical protein | - |
| GKS41_RS17430 | - | 3502141..3503364 (-) | 1224 | WP_007613436.1 | EAL and HDOD domain-containing protein | - |
| GKS41_RS17435 | - | 3503494..3504960 (-) | 1467 | WP_159354532.1 | nicotinate phosphoribosyltransferase | - |
| GKS41_RS17440 | - | 3504978..3505529 (-) | 552 | WP_003152033.1 | cysteine hydrolase family protein | - |
| GKS41_RS17445 | - | 3505626..3506024 (-) | 399 | WP_003152031.1 | YueI family protein | - |
Sequence
Protein
Download Length: 46 a.a. Molecular weight: 5518.30 Da Isoelectric Point: 4.9432
>NTDB_id=412038 GKS41_RS17420 WP_003152043.1 3501188..3501328(-) (degQ) [Bacillus velezensis strain DH8043]
MENKLEEVKQLLFRLENDIRETTDSLRNINKSIDQLDKFSYAMKIS
MENKLEEVKQLLFRLENDIRETTDSLRNINKSIDQLDKFSYAMKIS
Nucleotide
Download Length: 141 bp
>NTDB_id=412038 GKS41_RS17420 WP_003152043.1 3501188..3501328(-) (degQ) [Bacillus velezensis strain DH8043]
GTGGAAAACAAATTAGAAGAAGTAAAGCAATTATTATTCCGACTTGAAAATGATATCAGAGAAACAACCGACTCATTACG
AAACATTAACAAAAGCATTGATCAGCTCGATAAATTCTCATATGCAATGAAAATTTCTTAA
GTGGAAAACAAATTAGAAGAAGTAAAGCAATTATTATTCCGACTTGAAAATGATATCAGAGAAACAACCGACTCATTACG
AAACATTAACAAAAGCATTGATCAGCTCGATAAATTCTCATATGCAATGAAAATTTCTTAA
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| degQ | Bacillus subtilis subsp. subtilis str. 168 |
89.13 |
100 |
0.891 |