Detailed information    

insolico Bioinformatically predicted

Overview


Name   degQ   Type   Regulator
Locus tag   GKS41_RS17420 Genome accession   NZ_CP047268
Coordinates   3501188..3501328 (-) Length   46 a.a.
NCBI ID   WP_003152043.1    Uniprot ID   A3KLB4
Organism   Bacillus velezensis strain DH8043     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context


Location: 3496188..3506328
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  GKS41_RS17395 - 3496525..3496908 (-) 384 WP_014418761.1 hotdog fold thioesterase -
  GKS41_RS17400 comA 3496930..3497574 (-) 645 WP_014418762.1 response regulator transcription factor Regulator
  GKS41_RS17405 comP 3497655..3499949 (-) 2295 WP_159354531.1 histidine kinase Regulator
  GKS41_RS17410 comX 3499961..3500125 (-) 165 WP_007613432.1 competence pheromone ComX -
  GKS41_RS17415 - 3500125..3501036 (-) 912 WP_022553710.1 polyprenyl synthetase family protein -
  GKS41_RS17420 degQ 3501188..3501328 (-) 141 WP_003152043.1 degradation enzyme regulation protein DegQ Regulator
  GKS41_RS17425 - 3501793..3502134 (+) 342 WP_021495366.1 hypothetical protein -
  GKS41_RS17430 - 3502141..3503364 (-) 1224 WP_007613436.1 EAL and HDOD domain-containing protein -
  GKS41_RS17435 - 3503494..3504960 (-) 1467 WP_159354532.1 nicotinate phosphoribosyltransferase -
  GKS41_RS17440 - 3504978..3505529 (-) 552 WP_003152033.1 cysteine hydrolase family protein -
  GKS41_RS17445 - 3505626..3506024 (-) 399 WP_003152031.1 YueI family protein -

Sequence


Protein


Download         Length: 46 a.a.        Molecular weight: 5518.30 Da        Isoelectric Point: 4.9432

>NTDB_id=412038 GKS41_RS17420 WP_003152043.1 3501188..3501328(-) (degQ) [Bacillus velezensis strain DH8043]
MENKLEEVKQLLFRLENDIRETTDSLRNINKSIDQLDKFSYAMKIS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=412038 GKS41_RS17420 WP_003152043.1 3501188..3501328(-) (degQ) [Bacillus velezensis strain DH8043]
GTGGAAAACAAATTAGAAGAAGTAAAGCAATTATTATTCCGACTTGAAAATGATATCAGAGAAACAACCGACTCATTACG
AAACATTAACAAAAGCATTGATCAGCTCGATAAATTCTCATATGCAATGAAAATTTCTTAA

Domains


Predicted by InterproScan.

(1-46)


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB A3KLB4

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

89.13

100

0.891


Multiple sequence alignment