Detailed information    

insolico Bioinformatically predicted

Overview


Name   comGE   Type   Machinery gene
Locus tag   GKS41_RS14325 Genome accession   NZ_CP047268
Coordinates   2915069..2915383 (-) Length   104 a.a.
NCBI ID   WP_017418140.1    Uniprot ID   A0AAP3YC32
Organism   Bacillus velezensis strain DH8043     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 2910069..2920383
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  GKS41_RS14280 sinI 2910750..2910923 (+) 174 WP_159354372.1 anti-repressor SinI Regulator
  GKS41_RS14285 sinR 2910957..2911292 (+) 336 WP_003153104.1 transcriptional regulator SinR Regulator
  GKS41_RS14290 tasA 2911340..2912125 (-) 786 WP_017418136.1 biofilm matrix protein TasA -
  GKS41_RS14295 sipW 2912190..2912774 (-) 585 WP_012117977.1 signal peptidase I SipW -
  GKS41_RS14300 tapA 2912746..2913417 (-) 672 WP_014418371.1 amyloid fiber anchoring/assembly protein TapA -
  GKS41_RS14305 - 2913676..2914005 (+) 330 WP_012117979.1 DUF3889 domain-containing protein -
  GKS41_RS14310 - 2914046..2914225 (-) 180 WP_003153093.1 YqzE family protein -
  GKS41_RS14315 comGG 2914282..2914659 (-) 378 WP_017418138.1 competence type IV pilus minor pilin ComGG Machinery gene
  GKS41_RS14320 comGF 2914660..2915055 (-) 396 WP_021494311.1 competence type IV pilus minor pilin ComGF -
  GKS41_RS14325 comGE 2915069..2915383 (-) 315 WP_017418140.1 competence type IV pilus minor pilin ComGE Machinery gene
  GKS41_RS14330 comGD 2915367..2915804 (-) 438 WP_159354373.1 competence type IV pilus minor pilin ComGD Machinery gene
  GKS41_RS14335 comGC 2915794..2916102 (-) 309 WP_159354374.1 competence type IV pilus major pilin ComGC Machinery gene
  GKS41_RS14340 comGB 2916107..2917144 (-) 1038 WP_053284924.1 competence type IV pilus assembly protein ComGB Machinery gene
  GKS41_RS14345 comGA 2917131..2918201 (-) 1071 WP_159354375.1 competence type IV pilus ATPase ComGA Machinery gene
  GKS41_RS14350 - 2918394..2919344 (-) 951 WP_014418379.1 magnesium transporter CorA family protein -

Sequence


Protein


Download         Length: 104 a.a.        Molecular weight: 11785.77 Da        Isoelectric Point: 5.8181

>NTDB_id=412019 GKS41_RS14325 WP_017418140.1 2915069..2915383(-) (comGE) [Bacillus velezensis strain DH8043]
MLNGNKGFSTIETLSAMAIWLFLMTSIIPVWTGMLTDGLKIEDRQEAYQLLQKHISTYMMTGKKPPSPGVKWKEDGEYYK
VCAADPGEKEMCLSILKTDWLYAS

Nucleotide


Download         Length: 315 bp        

>NTDB_id=412019 GKS41_RS14325 WP_017418140.1 2915069..2915383(-) (comGE) [Bacillus velezensis strain DH8043]
ATGCTAAACGGAAATAAGGGGTTCTCTACTATTGAAACGCTATCAGCAATGGCCATTTGGCTGTTCCTTATGACGTCTAT
CATTCCAGTCTGGACGGGCATGCTGACAGATGGCCTGAAAATAGAAGATCGCCAGGAAGCGTACCAGCTTCTTCAGAAAC
ATATCAGCACTTATATGATGACCGGAAAAAAGCCGCCGTCTCCCGGTGTGAAGTGGAAGGAGGATGGTGAGTATTACAAA
GTGTGTGCGGCTGACCCCGGCGAAAAAGAAATGTGCCTCAGCATTCTCAAAACAGACTGGCTTTACGCTTCTTAA

Domains



No domain identified.



Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGE Bacillus subtilis subsp. subtilis str. 168

43.478

100

0.481


Multiple sequence alignment